DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and AT1G77570

DIOPT Version :10

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_177880.2 Gene:AT1G77570 / 844092 AraportID:AT1G77570 Length:147 Species:Arabidopsis thaliana


Alignment Length:124 Identity:38/124 - (30%)
Similarity:60/124 - (48%) Gaps:24/124 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKH----NNMASFIRQLNMYGF 109
            |..:::.:||||.|:.:|.|::...||:|.|..:|.:.:||   |:    .|::.|...|..:||
plant    27 FYMRVYEVVDDASTDAIISWSESNNSFIIWNVGEFYRRILP---KYVDLGTNLSRFFSNLRSHGF 88

  Fly   110 HKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRKISNNKNGDDKGVLKPEAMSK 168
             ||.....|.|       ||.|..|.|:.   |:.:|:.:|      ||...:..|.||
plant    89 -KIVKGRTGVL-------EFGHEDFIRDK---LELMKKMVS------DKRKARKAAKSK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 32/102 (31%)
Vert_HS_TF <579..711 CDD:461944
AT1G77570NP_177880.2 HSF_DNA-bind 26..116 CDD:472277 32/102 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.