DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and AT1G77570

DIOPT Version :9

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_177880.2 Gene:AT1G77570 / 844092 AraportID:AT1G77570 Length:147 Species:Arabidopsis thaliana


Alignment Length:124 Identity:38/124 - (30%)
Similarity:60/124 - (48%) Gaps:24/124 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKH----NNMASFIRQLNMYGF 109
            |..:::.:||||.|:.:|.|::...||:|.|..:|.:.:||   |:    .|::.|...|..:||
plant    27 FYMRVYEVVDDASTDAIISWSESNNSFIIWNVGEFYRRILP---KYVDLGTNLSRFFSNLRSHGF 88

  Fly   110 HKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRKISNNKNGDDKGVLKPEAMSK 168
             ||.....|.|       ||.|..|.|:.   |:.:|:.:|      ||...:..|.||
plant    89 -KIVKGRTGVL-------EFGHEDFIRDK---LELMKKMVS------DKRKARKAAKSK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 32/102 (31%)
Vert_HS_TF <607..711 CDD:284062
AT1G77570NP_177880.2 HSF 26..116 CDD:214654 32/102 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154048at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10015
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.