DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and HSFB4

DIOPT Version :9

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_175142.1 Gene:HSFB4 / 841110 AraportID:AT1G46264 Length:348 Species:Arabidopsis thaliana


Alignment Length:345 Identity:88/345 - (25%)
Similarity:141/345 - (40%) Gaps:76/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GSGVPA-FLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNM 106
            |..||| ||.|.::||||..|:.::.|..|..:||:....:||::|||..:||||.:||:||||.
plant    28 GKAVPAPFLTKTYQLVDDPATDHVVSWGDDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNT 92

  Fly   107 YGFHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRKISNNKNGDDKG------------ 159
            |||.||..          |..||::.||||....||.:|.|:.::........            
plant    93 YGFRKIVP----------DRWEFANEFFKRGEKHLLCEIHRRKTSQMIPQQHSPFMSHHHAPPQI 147

  Fly   160 --------------VLKPEAMSKILTDVKVMRGR----QDNLDSRFSAMKQENEVLWREIASLRQ 206
                          |..||.......|....|.|    |.:..::.:|:.::||.|.|....|..
plant   148 PFSGGSFFPLPPPRVTTPEEDHYWCDDSPPSRPRVIPQQIDTAAQVTALSEDNERLRRSNTVLMS 212

  Fly   207 KHAKQQQIVNKLIQFL---ITIVQPSRNMSGVKRHVQ-LMINNTPEIDRARTTSETESESGGGPV 267
            :.|..:::.|.:|.|:   :..|.||.|.|.:...:| ......|.:|...|.:...:..     
plant   213 ELAHMKKLYNDIIYFVQNHVKPVAPSNNSSYLSSFLQKQQQQQPPTLDYYNTATVNATNL----- 272

  Fly   268 IHELREELLDEVMNPSPAGYTAA---------SHYDQESVSPP---AVERPRSNMSISSHNVDYS 320
                      ..:|.||....::         :|:||.::...   .|..|.|..  .||:  :|
plant   273 ----------NALNSSPPTSQSSITVLEDDHTNHHDQSNMRKTKLFGVSLPSSKK--RSHH--FS 323

  Fly   321 NQSVEDLLLQGNGTAGGNIL 340
            :|:.:..|:........|::
plant   324 DQTSKTRLVLDQSDLALNLM 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 45/103 (44%)
Vert_HS_TF <607..711 CDD:284062
HSFB4NP_175142.1 HSF 32..124 CDD:214654 44/101 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 93 1.000 Domainoid score I2555
eggNOG 1 0.900 - - E1_COG5169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154048at2759
OrthoFinder 1 1.000 - - FOG0000255
OrthoInspector 1 1.000 - - otm2595
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10015
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X160
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.