DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and HSFA9

DIOPT Version :9

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_200218.1 Gene:HSFA9 / 835493 AraportID:AT5G54070 Length:331 Species:Arabidopsis thaliana


Alignment Length:356 Identity:86/356 - (24%)
Similarity:146/356 - (41%) Gaps:107/356 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EEEEDEEEQLPSR--RMHSYGDAAAIGSGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQA 81
            :||||:...|...  ::|..|       .:..||.|.:.:|||..|:.::.|:...:||:|.:..
plant    47 KEEEDDAVNLSLGFWKLHEIG-------LITPFLRKTFEIVDDKVTDPVVSWSPTRKSFIIWDSY 104

  Fly    82 QFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIK 146
            :|::.|||..:||.|.:|||||||.|||.|:          |.|..||::..|:.....||..||
plant   105 EFSENLLPKYFKHKNFSSFIRQLNSYGFKKV----------DSDRWEFANEGFQGGKKHLLKNIK 159

  Fly   147 RKISNNKNGDDKGVLKPEAMSKILTDVKVMRGRQDNLDSRFSAMKQENEVLWREIASLRQK---- 207
            |:..|.|..:     |..:.:...|:|:.::..|..:......:||:.|....::.::::|    
plant   160 RRSKNTKCCN-----KEASTTTTETEVESLKEEQSPMRLEMLKLKQQQEESQHQMVTVQEKIHGV 219

  Fly   208 -----H--------AKQQQIVNKLIQFLITIVQPSRNMSGVKRHVQLMINNTPEIDRARTTSETE 259
                 |        ||.|:.|.:|::        .|.|.     :|..:.....:.:.:...:.|
plant   220 DTEQQHMLSFFAKLAKDQRFVERLVK--------KRKMK-----IQRELEAAEFVKKLKLLQDQE 271

  Fly   260 SESGGGPVIHELREELLDEVMNPSPAGYTAASHYDQESVSPPAVERPRSNMSISSHNVD----YS 320
            ::           :.|||                         |||....|:.:.||.:    .:
plant   272 TQ-----------KNLLD-------------------------VEREFMAMAATEHNPEPDILVN 300

  Fly   321 NQS--------VEDLLLQGNGTAGGNILVGG 343
            |||        .||||:.     ||::.|.|
plant   301 NQSGNTRCQLNSEDLLVD-----GGSMDVNG 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 38/102 (37%)
Vert_HS_TF <607..711 CDD:284062
HSFA9NP_200218.1 HSF 71..161 CDD:214654 38/99 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 93 1.000 Domainoid score I2555
eggNOG 1 0.900 - - E1_COG5169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154048at2759
OrthoFinder 1 1.000 - - FOG0000255
OrthoInspector 1 1.000 - - otm2595
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10015
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X160
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.