DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and RHA1

DIOPT Version :9

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_001331800.1 Gene:RHA1 / 834610 AraportID:AT5G45710 Length:345 Species:Arabidopsis thaliana


Alignment Length:375 Identity:84/375 - (22%)
Similarity:167/375 - (44%) Gaps:73/375 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYG 108
            |.:|.||.|.:.:|||:.::.::.|:::.:||:::|.|:|:::|||..:||.|.:|||||||.||
plant     9 SSLPPFLTKTYEMVDDSSSDSVVAWSENNKSFIVKNPAEFSRDLLPRFFKHKNFSSFIRQLNTYG 73

  Fly   109 FHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRKISNNKNGDDKGVLKP---EAMSKIL 170
            |.|:          |.::.||.:..|.|..|:|:..|.|:             ||   .::..:.
plant    74 FRKV----------DPEKWEFLNDDFVRGRPYLMKNIHRR-------------KPVHSHSLVNLQ 115

  Fly   171 TDVKVMRGRQDNLDSRFSAMKQENEVLWREIASLRQKHAKQQQIVNKLIQFLITIVQPSRNMSGV 235
            ....:....:.:::.:...:|.|.|.|..|:.:..|:..          :|.:.:......:..:
plant   116 AQNPLTESERRSMEDQIERLKNEKEGLLAELQNQEQERK----------EFELQVTTLKDRLQHM 170

  Fly   236 KRHVQLMINNTPEI-DRARTTSETESESGGGPVIHELREELLDEVMNPSPAGYTAASHYDQESVS 299
            ::|.:.::....:: .:...:...|:        ||.|:....|  |..|   .::||.:|    
plant   171 EQHQKSIVAYVSQVLGKPGLSLNLEN--------HERRKRRFQE--NSLP---PSSSHIEQ---- 218

  Fly   300 PPAVERPRSNMSISSHNVDYSNQSVEDLLLQGNG---TAGGNILVGGAASPMAQSVSQSPAQHDV 361
               ||:..|:::...:.|   ::|.|...||.:.   .|..:.|..|...|.:..:..: ::..|
plant   219 ---VEKLESSLTFWENLV---SESCEKSGLQSSSMDHDAAESSLSIGDTRPKSSKIDMN-SEPPV 276

  Fly   362 YTVTEAPDSHVQEVPNSPPYYEEQNVLTTPMVREQEQ---QKRQQLKENN 408
            .....||.:.|.:      .:.||.:...|...||::   ::|....:||
plant   277 TVTAPAPKTGVND------DFWEQCLTENPGSTEQQEVQSERRDVGNDNN 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 38/102 (37%)
Vert_HS_TF <607..711 CDD:284062
RHA1NP_001331800.1 HSF 10..103 CDD:214654 38/102 (37%)
Flagellar_rod 107..>239 CDD:368306 23/164 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 93 1.000 Domainoid score I2555
eggNOG 1 0.900 - - E1_COG5169
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154048at2759
OrthoFinder 1 1.000 - - FOG0000255
OrthoInspector 1 1.000 - - otm2595
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10015
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X160
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.