DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and HSFA3

DIOPT Version :9

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_001318473.1 Gene:HSFA3 / 831749 AraportID:AT5G03720 Length:412 Species:Arabidopsis thaliana


Alignment Length:283 Identity:74/283 - (26%)
Similarity:118/283 - (41%) Gaps:71/283 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GSGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMY 107
            |:.:|.||:|.:.||||...:.:|.|...|.|||:.:..:||:.:||.|:||||.:||:||||.|
plant    50 GNPIPPFLSKTFDLVDDPTLDPVISWGLTGASFVVWDPLEFARIILPRNFKHNNFSSFVRQLNTY 114

  Fly   108 GFHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRKISNNKNGDDKGVLKPEAMSKILTD 172
            ||.||          |.|:.||::..|.|....||..|.|:.|            |::.....:.
plant   115 GFRKI----------DTDKWEFANEAFLRGKKHLLKNIHRRRS------------PQSNQTCCSS 157

  Fly   173 VKVMRGRQDNLDSRFSAMKQENEVLWREIASLRQ----------------KHAKQQQIVNKLIQF 221
            ....:|....:......:::|...|..|:..|:|                |.|:|:|  .:|:.|
plant   158 TSQSQGSPTEVGGEIEKLRKERRALMEEMVELQQQSRGTARHVDTVNQRLKAAEQRQ--KQLLSF 220

  Fly   222 LITIVQPSRNMSGVKRHVQLMINNTPEIDRARTTSETESESGGGPVIHELREELLDEVMNP--SP 284
            |..:.|                 |...::|.:...  ..|.||...:.:.|::.:.....|  ||
plant   221 LAKLFQ-----------------NRGFLERLKNFK--GKEKGGALGLEKARKKFIKHHQQPQDSP 266

  Fly   285 AGYTAASH----------YDQES 297
            .|.....:          ||:|:
plant   267 TGGEVVKYEADDWERLLMYDEET 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 43/102 (42%)
Vert_HS_TF <607..711 CDD:284062
HSFA3NP_001318473.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 93 1.000 Domainoid score I2555
eggNOG 1 0.900 - - E1_COG5169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154048at2759
OrthoFinder 1 1.000 - - FOG0000255
OrthoInspector 1 1.000 - - otm2595
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10015
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X160
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.