DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and HSF4

DIOPT Version :9

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_195416.1 Gene:HSF4 / 829853 AraportID:AT4G36990 Length:284 Species:Arabidopsis thaliana


Alignment Length:250 Identity:78/250 - (31%)
Similarity:119/250 - (47%) Gaps:64/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VPA-FLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGF 109
            ||| ||:|.::||||..|:.::.|.::|.:||:...|:|||:|||..:||||.:|||||||.|||
plant    11 VPAPFLSKTYQLVDDHSTDDVVSWNEEGTAFVVWKTAEFAKDLLPQYFKHNNFSSFIRQLNTYGF 75

  Fly   110 HKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRK------------------ISNNKNGD 156
            .|...          |:.||::.:|:|....||..|:|:                  .||:..||
plant    76 RKTVP----------DKWEFANDYFRRGGEDLLTDIRRRKSVIASTAGKCVVVGSPSESNSGGGD 130

  Fly   157 DKG---------VLKPEAMSKILTDVKVMRGRQDNLDSRFSAMKQENEVLWREIASLRQKHAKQQ 212
            |.|         ...|.::..::.|   :.|..:.|       |:||..|..|:|:     ||:|
plant   131 DHGSSSTSSPGSSKNPGSVENMVAD---LSGENEKL-------KRENNNLSSELAA-----AKKQ 180

  Fly   213 QIVNKLIQFLI--TIVQPSRNMSGVKRHVQLMINNTPEIDRARTTSETESESGGG 265
            :  ::|:.||.  ..|:|.:....:|......:.:..|       ||.|...|||
plant   181 R--DELVTFLTGHLKVRPEQIDKMIKGGKFKPVESDEE-------SECEGCDGGG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 45/102 (44%)
Vert_HS_TF <607..711 CDD:284062
HSF4NP_195416.1 HSF 12..104 CDD:214654 44/101 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 93 1.000 Domainoid score I2555
eggNOG 1 0.900 - - E1_COG5169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154048at2759
OrthoFinder 1 1.000 - - FOG0000255
OrthoInspector 1 1.000 - - otm2595
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10015
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X160
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.