DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and AT4G19630

DIOPT Version :9

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_193698.2 Gene:AT4G19630 / 827705 AraportID:AT4G19630 Length:131 Species:Arabidopsis thaliana


Alignment Length:96 Identity:24/96 - (25%)
Similarity:49/96 - (51%) Gaps:7/96 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYG 108
            :|:..|...:::||:|..::.:|.|:|....||:.|:....:..:.|.:....::.|:.:|..||
plant     7 NGLGTFYIGIYKLVEDPSSDPIISWSKSNNGFVMCNEEARIRSKILLRFNCGKLSEFLSELKYYG 71

  Fly   109 FHKITSIDNGGLRFDRDEIEFSHPFFKRNSP 139
            |.::...|:|       ::||.:..|.|..|
plant    72 FTRVKKTDSG-------KMEFRNEDFVRGQP 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 24/95 (25%)
Vert_HS_TF <607..711 CDD:284062
AT4G19630NP_193698.2 HSF 8..104 CDD:214654 24/95 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10015
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.