DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and AT4G18870

DIOPT Version :9

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_193622.1 Gene:AT4G18870 / 827621 AraportID:AT4G18870 Length:291 Species:Arabidopsis thaliana


Alignment Length:178 Identity:47/178 - (26%)
Similarity:91/178 - (51%) Gaps:23/178 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EEQLPSRRMHSYGDAAAIGSGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLP 89
            ::|||..  :||..     |.:| |..|::.:|||..::.:|.|::.|:||:|.|..:|.|:.|.
plant   131 QDQLPPH--NSYPT-----SKLP-FPTKIYEMVDDPSSDAIISWSQSGKSFIIWNPQEFCKDHLR 187

  Fly    90 LNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRKISNNKN 154
            ..:...::..|..:|.::||.||          :..:.||::..|.|....|::.|   |||:|.
plant   188 RLFNTLHIHFFFYKLKIFGFKKI----------NPKKWEFANDNFVRGQRHLVEII---ISNDKK 239

  Fly   155 GDDKGVLKPEAMSKILTDV-KVMRGRQDNLDSRFSAMKQENEVLWREI 201
            .:|: :.|.:|..|.:.:. ::.:.:.:.:......||:..||..:|:
plant   240 KNDQ-LRKQDAREKKMAEAGELFKLQIEEMSDMRKKMKKAKEVKEQEV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 28/102 (27%)
Vert_HS_TF <607..711 CDD:284062
AT4G18870NP_193622.1 HSF 10..100 CDD:214654
HSF 146..234 CDD:214654 28/101 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154048at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10015
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.