DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and HSFA6B

DIOPT Version :9

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_188922.1 Gene:HSFA6B / 821854 AraportID:AT3G22830 Length:406 Species:Arabidopsis thaliana


Alignment Length:375 Identity:94/375 - (25%)
Similarity:167/375 - (44%) Gaps:75/375 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYG 108
            ||.|.||.|.:.||:|:.||.::.|:|...||::.:...|:..|||..:||||.:||:||||.||
plant    57 SGPPPFLTKTYDLVEDSRTNHVVSWSKSNNSFIVWDPQAFSVTLLPRFFKHNNFSSFVRQLNTYG 121

  Fly   109 FHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQI-KRKISNNKNGDDKGVLKPEAMSKILTD 172
            |.|:          :.|..||::..|.|....||..| :||.|||.|    .:.:|::..:...|
plant   122 FRKV----------NPDRWEFANEGFLRGQKHLLKNIRRRKTSNNSN----QMQQPQSSEQQSLD 172

  Fly   173 VKVMRGRQDNLDSRFSAMKQENEVLWREIASLRQKHAKQQQIVNKLIQFLITIVQP--SRNMSGV 235
            ...:...:..||....:::::.:||..|:..|||    |||..    :..:|:::.  .:..|..
plant   173 NFCIEVGRYGLDGEMDSLRRDKQVLMMELVRLRQ----QQQST----KMYLTLIEEKLKKTESKQ 229

  Fly   236 KRHVQLMINNTPEIDRARTTSETESESGGGPVIHELREELLDEVMNPSPAGYTAASHYDQESVSP 300
            |:.:..:.......|..:...|.:          |.|:|:                   :|::|.
plant   230 KQMMSFLARAMQNPDFIQQLVEQK----------EKRKEI-------------------EEAISK 265

  Fly   301 PAVERPRSNMSISSHNVDYSNQSVEDLLLQGNGTAGGNILVGGAASPMAQSVSQSPAQHDVYTVT 365
            .. :||          :|...::|||   .|:.:..||.:...:::.:..|...:......:.::
plant   266 KR-QRP----------IDQGKRNVED---YGDESGYGNDVAASSSALIGMSQEYTYGNMSEFEMS 316

  Fly   366 EAPD--SHVQEVPNSPPYYEEQNVLTTPMVREQEQQKRQQL---KENNKL 410
            |...  .|:|.:.::....||  ||......::|:.:.||.   ||||::
plant   317 ELDKLAMHIQGLGDNSSAREE--VLNVEKGNDEEEVEDQQQGYHKENNEI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 40/103 (39%)
Vert_HS_TF <607..711 CDD:284062
HSFA6BNP_188922.1 HSF 58..151 CDD:214654 40/102 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 93 1.000 Domainoid score I2555
eggNOG 1 0.900 - - E1_COG5169
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154048at2759
OrthoFinder 1 1.000 - - FOG0000255
OrthoInspector 1 1.000 - - otm2595
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10015
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X160
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.