DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and HSFB3

DIOPT Version :9

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_181700.1 Gene:HSFB3 / 818767 AraportID:AT2G41690 Length:244 Species:Arabidopsis thaliana


Alignment Length:225 Identity:64/225 - (28%)
Similarity:108/225 - (48%) Gaps:35/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KHESEEEEEDEEEQLPSRRMHSYGDAAAIGSGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQ 78
            :|....:..::||:||...|.....:.|.....|.||.|.:::|:|..|:.:|.|.:.|..||:.
plant     6 EHLRCNDNVNDEERLPLEFMIGNSTSTAELQPPPPFLVKTYKVVEDPTTDGVISWNEYGTGFVVW 70

  Fly    79 NQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLD 143
            ..|:||::|||..:||.|.:||:||||.|||.|:|:|          ..|||:..|::....|:.
plant    71 QPAEFARDLLPTLFKHCNFSSFVRQLNTYGFRKVTTI----------RWEFSNEMFRKGQRELMS 125

  Fly   144 QIKRK----ISNNKNGDD----KGVLKPEAMSKILTDVKVMRGRQDNLDSRFSA----------- 189
            .|:|:    .|:||:...    ..::..|...:|..|    ...:|...|..|:           
plant   126 NIRRRKSQHWSHNKSNHQVVPTTTMVNQEGHQRIGID----HHHEDQQSSATSSSFVYTALLDEN 186

  Fly   190 --MKQENEVLWREIASLRQKHAKQQQIVNK 217
              :|.|||:|..|:...::|..:..::|.:
plant   187 KCLKNENELLSCELGKTKKKCKQLMELVER 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 39/102 (38%)
Vert_HS_TF <607..711 CDD:284062
HSFB3NP_181700.1 HSF 37..130 CDD:214654 39/102 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 93 1.000 Domainoid score I2555
eggNOG 1 0.900 - - E1_COG5169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154048at2759
OrthoFinder 1 1.000 - - FOG0000255
OrthoInspector 1 1.000 - - otm2595
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10015
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X160
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.