DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and Hsfy2

DIOPT Version :9

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_001012132.1 Gene:Hsfy2 / 316409 RGDID:1311885 Length:393 Species:Rattus norvegicus


Alignment Length:287 Identity:69/287 - (24%)
Similarity:116/287 - (40%) Gaps:98/287 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EEDEEEQLPSRRMHSYGDAAAIGSGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAK 85
            |.||:..|.|.                .|..|||::| .:|..:.|.|.:|| ::::.|:..|.|
  Rat    69 EPDEDSNLFSM----------------TFPRKLWKIV-GSDKFKSIWWDEDG-TYIVINEELFKK 115

  Fly    86 ELL----PLN-YKHNNMASFIRQLNMYGFHKITSIDNGGLRFDRD-----------------EIE 128
            |:|    |.. ::.::|.|.:||||:|||.|:..      .|.|.                 :::
  Rat   116 EVLERKAPFRIFETDSMKSLVRQLNLYGFRKMRQ------NFQRSASLPDFLAEEKGISASCKLQ 174

  Fly   129 F-SHPFFKRNSPFLLDQIKRKIS---------------NNKN------------------GDDKG 159
            | .:|.|.|:.|.|::::||:|.               .||:                  ..::.
  Rat   175 FYQNPNFLRDCPHLIERMKRRIGIKTVSRGAAPSLPDFKNKHFRPDLGKMDDHSLGVAVQTSERN 239

  Fly   160 VLKPEAMSKILTDVK--VMRGRQDNLD---SRF-----SAMKQENEVLWREIASLR---QKHAKQ 211
            :|...::|.:....|  :.:|..|::|   |.|     |:.:...|||....|.|.   ..|...
  Rat   240 LLSGSSISNVYLRQKPSLTQGSSDSMDVIRSDFSLATSSSFRPPEEVLTHRPAPLNDVSSLHMDS 304

  Fly   212 QQIV----NKLIQFLIT-IVQPSRNMS 233
            |:|.    :..:.|:|| |.|..|:||
  Rat   305 QRIYTQANDSTVNFIITSITQNRRDMS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 35/125 (28%)
Vert_HS_TF <607..711 CDD:284062
Hsfy2NP_001012132.1 HSF_DNA-bind 81..195 CDD:395358 35/121 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349197
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10015
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.