DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and HSFY2

DIOPT Version :9

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_714927.1 Gene:HSFY2 / 159119 HGNCID:23950 Length:401 Species:Homo sapiens


Alignment Length:354 Identity:93/354 - (26%)
Similarity:143/354 - (40%) Gaps:77/354 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLN-----YKHNNMASFIRQLNMYG 108
            |..|||::| ::|..:.|.|.::|...|| |:..|.||:|...     ::.:.:.||:||||:||
Human    80 FPRKLWKIV-ESDQFKSISWDENGTCIVI-NEELFKKEILETKAPYRIFQTDAIKSFVRQLNLYG 142

  Fly   109 FHKITSIDNGGLRFDR---------DEIEFS---------HPFFKRNSPFLLDQIKRKISNNKNG 155
            |.||..      .|.|         :|.|.|         :|.|||..|.||.::||:| ..||.
Human   143 FSKIQQ------NFQRSAFLATFLSEEKESSVLSKLKFYYNPNFKRGYPQLLVRVKRRI-GVKNA 200

  Fly   156 DDKGVLKPEAMSKILTDVKVMR------------GRQDNLDSRFSAMKQENEVLWREIASLRQKH 208
            .....|..|..:|     |..|            ..:.:.:|.|||.|..|..|.|| :|:|   
Human   201 SPISTLFNEDFNK-----KHFRAGANMENHNSALAAEASEESLFSASKNLNMPLTRE-SSVR--- 256

  Fly   209 AKQQQIVNKLIQFLITIVQPSRNMSGVKRHVQLMINNTPEIDRARTTSETESES----GGGPVIH 269
               |.|.|..:........||.:.| |....|:..:....:::. ||....|.|    ..|.:::
Human   257 ---QIIANSSVPIRSGFPPPSPSTS-VGPSEQIATDQHAILNQL-TTIHMHSHSTYMQARGHIVN 316

  Fly   270 ELREELLD-EVMNPSPAGYTAASHYDQESVSPPAVERPRSNMSISSHNVDYSNQSVEDLLLQGNG 333
            .:...... .:::|...||...      :|.|.||  |.....:|.:...|.|     :|..||.
Human   317 FITTTTSQYHIISPLQNGYFGL------TVEPSAV--PTRYPLVSVNEAPYRN-----MLPAGNP 368

  Fly   334 TAGGNILVGGAASPMAQSVSQSPAQHDVY 362
            ......:...:|:|.::...| |:..|.|
Human   369 WLQMPTIADRSAAPHSRLALQ-PSPLDKY 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 40/121 (33%)
Vert_HS_TF <607..711 CDD:284062
HSFY2NP_714927.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
HFS-type DNA-binding domain 79..213 46/141 (33%)
HSF_DNA-bind 80..194 CDD:306863 40/121 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10015
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.