DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and HSFX3

DIOPT Version :9

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_001310008.1 Gene:HSFX3 / 101928917 HGNCID:52395 Length:333 Species:Homo sapiens


Alignment Length:192 Identity:53/192 - (27%)
Similarity:86/192 - (44%) Gaps:39/192 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLN-----YKHNNMASFIRQLNMY 107
            :|..|||.:|:: ||.:.:.|..||.:.:|.... |.:|:|...     :|.:::.|||||||:|
Human    82 SFPRKLWTIVEE-DTFKSVSWNDDGDAVIIDKDL-FQREVLQRKGAERIFKTDSLTSFIRQLNLY 144

  Fly   108 GFHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRKISNNKNGDDKGVLKPEAMSKILTD 172
            ||.|....::.|   ::..:.:.:..|:|:.|.||:.|:|          |..|:..|...    
Human   145 GFCKTRPSNSPG---NKKMMIYCNSNFQRDKPRLLENIQR----------KDALRNTAQQA---- 192

  Fly   173 VKVMRGRQDNLDSRFSAMKQENEVLWREIASLRQKHAKQQQIVNKLIQFLITIVQ-PSRNMS 233
                        :|....|::|.|..|.  |||..|...::...|:.|.....|| ||...|
Human   193 ------------TRVPTPKRKNLVATRR--SLRIYHINARKEAIKMCQQGAPSVQGPSGTQS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 33/104 (32%)
Vert_HS_TF <607..711 CDD:284062
HSFX3NP_001310008.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..66
HSF_DNA-bind 83..182 CDD:306863 34/113 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..275 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10015
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.