DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsf and hsf2

DIOPT Version :10

Sequence 1:NP_001036555.1 Gene:Hsf / 37068 FlyBaseID:FBgn0001222 Length:733 Species:Drosophila melanogaster
Sequence 2:XP_002937263.1 Gene:hsf2 / 100125207 XenbaseID:XB-GENE-954977 Length:530 Species:Xenopus tropicalis


Alignment Length:208 Identity:44/208 - (21%)
Similarity:81/208 - (38%) Gaps:63/208 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LLLCL------SL-LLALRTG-----NSYRSDRNQSRPVS--FIDTLIWMVGVLAQQGSIIRPNS 153
            |||||      :| |...::|     |:.:..:.:...|.  |...||.::.::     :.|...
 Frog    21 LLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFFSRLIQILKIM-----VPRTFC 80

  Fly   154 SSSMVIILVALYMSAIIYCSYLTKIASLLSVDASVNLDLQTVLSAGQYQIGFVGNNTADETVIQK 218
            ..:..::|:|:.:.:..||                  |:..:.:....:.|.:|.:..|    .|
 Frog    81 KETGYLVLIAVMLVSRTYC------------------DVWMIQNGTLIESGIIGRSRKD----FK 123

  Fly   219 RYDPVMNEI----MRRMVQNSSLYSLSHEHALHRVLTTKYVL-----------IGNVGSVRKA-- 266
            ||  ::|.|    :..:|.|...|.|:......||..|||:.           :||:.: |.|  
 Frog   124 RY--LLNFIAAMPLISLVNNFLKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDN-RIANP 185

  Fly   267 --MQTLDEQQNCN 277
              :.|.|.::.||
 Frog   186 DQLLTQDVEKFCN 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HsfNP_001036555.1 HSF 45..148 CDD:214654 13/58 (22%)
Vert_HS_TF <579..711 CDD:461944
hsf2XP_002937263.1 HSF <48..126 CDD:214654 16/106 (15%)
Vert_HS_TF 246..495 CDD:461944
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.