DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema5c and SEMA6D

DIOPT Version :9

Sequence 1:NP_611293.3 Gene:Sema5c / 37066 FlyBaseID:FBgn0284221 Length:1093 Species:Drosophila melanogaster
Sequence 2:NP_001345281.1 Gene:SEMA6D / 80031 HGNCID:16770 Length:1086 Species:Homo sapiens


Alignment Length:473 Identity:146/473 - (30%)
Similarity:244/473 - (51%) Gaps:40/473 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RNQVIVGARDTLYRMSF------DLEPLERASWGATPSEIAMCQAKGQSERWCRNYVRVLHSYGE 140
            |:.:.:..||.:|.::.      ::.|.::.:|.:...:...|..||:.:..|.|:::|.....:
Human    66 RDTLYIAGRDQVYTVNLNEMPKTEVIPNKKLTWRSRQQDRENCAMKGKHKDECHNFIKVFVPRND 130

  Fly   141 NQLYACGTNAFQPSCSWRQMENLTVTGVD-SGVVKCPFHPQANSTSLLQSNGQLFVGTATDFSGS 204
            ..::.||||||.|.|.:.::..|...|.: ||:.:|||..:..:.:|. ::|:|:..|..||..|
Human   131 EMVFVCGTNAFNPMCRYYRLSTLEYDGEEISGLARCPFDARQTNVALF-ADGKLYSATVADFLAS 194

  Fly   205 DVAILRTGVESNKRFLRTKQYNNNWLSGAQFVGSFEAGHFVYFLLRESAAEHMSCGKVIYSRVAR 269
            |..|.|:..:.:.  |||.:|::.|:....|:.:.|.|::|||..||.|.||.:.||.:||||||
Human   195 DAVIYRSMGDGSA--LRTIKYDSKWIKEPHFLHAIEYGNYVYFFFREIAVEHNNLGKAVYSRVAR 257

  Fly   270 VCKNDVGGGGQLLRDNWTSFLKARLNCSLPGEYPYYFDEIQGMT---YAESESILYATFRTSGSS 331
            :||||:||..::|..:||||||||||||:||:..:|||.:|.:|   .......:...|.|..:|
Human   258 ICKNDMGGSQRVLEKHWTSFLKARLNCSVPGDSFFYFDVLQSITDIIQINGIPTVVGVFTTQLNS 322

  Fly   332 IFGSAVCAYNLSSINAAFDGPFKQQEHSDAAWKTVNTNQRSQFQ---CGTSSIGHWLESS----- 388
            |.||||||:::..|...|.|.||:|:..|:.|..|..::..:.:   |....:....::|     
Human   323 IPGSAVCAFSMDDIEKVFKGRFKEQKTPDSVWTAVPEDKVPKPRPGCCAKHGLAEAYKTSIDFPD 387

  Fly   389 -------RYQLMDEAVQPIGAEPLYHSKLEQFGRLALDIINT--KTEQVHVLFVASSGNHIKKLS 444
                   .:.|||.||.||..||.:.....::...|:.:.::  ..:...|:||.|....:.|:.
Human   388 ETLSFIKSHPLMDSAVPPIADEPWFTKTRVRYRLTAISVDHSAGPYQNYTVIFVGSEAGMVLKVL 452

  Fly   445 VKYD----GDGVQTCLVELW-----QADDTGTSSLLNMAYLKVSDSLYLGTDLALTRIPAQHCSR 500
            .|..    .|.|....:|.:     .|::.....::::...|...:||:.....:.|||...|.|
Human   453 AKTSPFSLNDSVLLEEIEAYNHAKCSAENEEDKKVISLQLDKDHHALYVAFSSCIIRIPLS
RCER 517

  Fly   501 HVS-QSSCLNSMDPYCGW 517
            :.| :.||:.|.||||||
Human   518 YGSCKKSCIASRDPYCGW 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema5cNP_611293.3 Sema_5C 65..496 CDD:200526 134/449 (30%)
PSI 497..546 CDD:279745 12/22 (55%)
TSP1 556..607 CDD:214559
TSP1 610..663 CDD:214559
TSP1 674..725 CDD:214559
TSP1 802..834 CDD:214559
TSP1 853..901 CDD:214559
TSP1 906..953 CDD:214559
SEMA6DNP_001345281.1 Sema_6D 49..513 CDD:200530 134/449 (30%)
PSI 514..>543 CDD:307546 12/22 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 757..788
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 800..838
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 852..887
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 927..1018
Herpes_BLLF1 944..>1080 CDD:330317
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1034..1086
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.