DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema5c and SEMA4A

DIOPT Version :9

Sequence 1:NP_611293.3 Gene:Sema5c / 37066 FlyBaseID:FBgn0284221 Length:1093 Species:Drosophila melanogaster
Sequence 2:NP_001180229.1 Gene:SEMA4A / 64218 HGNCID:10729 Length:761 Species:Homo sapiens


Alignment Length:593 Identity:166/593 - (27%)
Similarity:265/593 - (44%) Gaps:101/593 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LKLPKMFSQLWLLL---ILSLLTLEGPQPSTGSG----------YTTKSSVDLLENDSRYISYQD 57
            :.||.:....|.||   :..||.|..|..:.|.|          |.        .::.|.:|:  
Human     1 MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYYA--------GDERRALSF-- 55

  Fly    58 LMSTAKRFYDPETTWYSEMLFDVARNQVIVGARDTLYRMSFDLEPLERAS----WGATPSEIAMC 118
                   |:......:..:|.....|.:.||||:.:..:......:.|..    |.|:..:.:.|
Human    56 -------FHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSEC 113

  Fly   119 QAKGQS-ERWCRNYVRVLHSYGENQLYACGTNAFQPSCSWRQMEN-----LTVTGVDSGVVKCPF 177
            ..|.:| |..|.|::|||.||....||.|||.||.|:|::.::::     ::...|..|..:.||
Human   114 AFKKKSNETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPF 178

  Fly   178 HPQANSTSLLQSNGQLFVGTATDFSGSDVAILRT----GVESNKRFLRTKQYNNNWL-SGAQFVG 237
            .|....|::| .:|.|:.||..:|.||:..::||    .|.....|||       || ..|.||.
Human   179 DPAHKHTAVL-VDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDNFLR-------WLHHDASFVA 235

  Fly   238 SFEAGHFVYFLLRESAAEHMSCGKVIYSRVARVCKNDVGGGGQLLRDNWTSFLKARLNCSLPGEY 302
            :..:...|||...|:|:|.....::..||||||||||| ||.:||:..||:||||:|.|:.||:.
Human   236 AIPSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDV-GGEKLLQKKWTTFLKAQLLCTQPGQL 299

  Fly   303 PYYFDEIQGMTYAESESI--LYATFRTSGSSIFG---SAVCAYNLSSINAAFDGPFKQQEHSDAA 362
            |:.......:..|:|.:.  :||.| ||...:.|   |||||::|..|...|.|.:|:.....:.
Human   300 PFNVIRHAVLLPADSPTAPHIYAVF-TSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKETSR 363

  Fly   363 WKTV---NTNQRSQFQCGTSSIGHWLESS-----RYQLMDEAVQPIGAEPLYHSKLEQFGRLALD 419
            |.|.   .||.|.    |:.|:|...:.:     .:.||||  |.:|...|..|.:| :.|||::
Human   364 WTTYRGPETNPRP----GSCSVGPSSDKALTFMKDHFLMDE--QVVGTPLLVKSGVE-YTRLAVE 421

  Fly   420 IINTKTEQVH-VLFVASSGNHIKKLSVKYDGDGVQTCLVELWQADDTGTSSLLNMAYLKVSDSLY 483
            .........| |:::.::...:.|..|  .||.....:.|:....|  ...:.|:.......:::
Human   422 TAQGLDGHSHLVMYLGTTTGSLHKAVV--SGDSSAHLVEEIQLFPD--PEPVRNLQLAPTQGAVF 482

  Fly   484 LGTDLALTRIPAQHCSRHVSQSSCLNSMDPYCGWNELVERCMPQPQDSSVLQHWHQAPQITCPVL 548
            :|....:.|:|..:||.:.|...|:.:.||:|.|:       |:.:              ||.:|
Human   483 VGFSGGVWRVPRANCSVYESCVDCVLARDPHCAWD-------PESR--------------TCCLL 526

  Fly   549 NAPIDGGW 556
            :||....|
Human   527 SAPNLNSW 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema5cNP_611293.3 Sema_5C 65..496 CDD:200526 137/459 (30%)
PSI 497..546 CDD:279745 10/48 (21%)
TSP1 556..607 CDD:214559 1/1 (100%)
TSP1 610..663 CDD:214559
TSP1 674..725 CDD:214559
TSP1 802..834 CDD:214559
TSP1 853..901 CDD:214559
TSP1 906..953 CDD:214559
SEMA4ANP_001180229.1 Sema_4A 55..495 CDD:200517 137/469 (29%)
PSI 496..541 CDD:214655 15/60 (25%)
Ig 566..638 CDD:353325
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 722..749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D41799at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.