DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema5c and Sema3d

DIOPT Version :9

Sequence 1:NP_611293.3 Gene:Sema5c / 37066 FlyBaseID:FBgn0284221 Length:1093 Species:Drosophila melanogaster
Sequence 2:NP_001098103.1 Gene:Sema3d / 246262 RGDID:727939 Length:777 Species:Rattus norvegicus


Alignment Length:553 Identity:162/553 - (29%)
Similarity:281/553 - (50%) Gaps:71/553 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLLILSLLTLEGPQPSTGSGYTTKSSVDLLENDSRYISYQDLM--STAKRFY-DPETTWYSEMLF 78
            ::||:::|.|    |.|   .|:|.::..|:     ::|:||:  :|...|. ..|...:..:|.
  Rat    23 MMLIVTVLYL----PVT---ETSKQNIPRLK-----LTYKDLLLSNTCIPFLGSSEGLDFQTLLL 75

  Fly    79 DVARNQVIVGARDTLYRMSF-DL-EPLERASWGATPSEIAMCQAKGQ-SERWCRNYVRVLHSYGE 140
            |..|..:::||:|.::.::. || :..::..|.|....:.:|:..|: :...|.|::|||..|.:
  Rat    76 DEERGILLLGAKDHVFLLNLVDLNKNFKKIYWPAAKERVELCKLAGKDANTECANFIRVLQPYNK 140

  Fly   141 NQLYACGTNAFQPSCSWRQME--------NLTVTGVDSGVVKCPFHPQANSTSLLQSNGQLFVGT 197
            ..:|.|||.||.|.|.:..:.        .|.:..::||.:||||.||....|:: ::..|:.||
  Rat   141 THVYVCGTGAFHPLCGYIDLGANKEELIFKLDMQNLESGRLKCPFDPQQPFASVM-TDEHLYSGT 204

  Fly   198 ATDFSGSDVAILRT-GVESNKRFLRTKQYNNNWLSGAQFVGSFEA-------GHFVYFLLRESAA 254
            |:||.|.|.|..|: |:..:..::||....:.||:||:|:|:|..       ...:||..|||:.
  Rat   205 ASDFLGKDTAFTRSLGLMQDHHYIRTDISEHYWLNGAKFIGTFPIPDTYNPDDDKIYFFFRESSQ 269

  Fly   255 EHMSCGKVIYSRVARVCKNDVGGGGQLLRDNWTSFLKARLNCSLPGE--YPYYFDEIQGM----T 313
            |..:..:.|.|||.|||||||||...|: :.||:||||||.||:||.  ...:|||:|.:    |
  Rat   270 EGSTSDRSILSRVGRVCKNDVGGQRSLI-NKWTTFLKARLVCSIPGSDGADTHFDELQDIYLLPT 333

  Fly   314 YAESESILYATFRTSGSSIFGSAVCAYNLSSINAAFDGPFKQQEHSDAAWKTVNTNQRSQF---- 374
            ..|...::|..|.|:.|...|||||.|:::.|.|.|:||:..:|.:|..|  |..:.|..:    
  Rat   334 RDERNPVVYGVFTTTSSIFKGSAVCVYSMADIRAVFNGPYAHKESADHRW--VQYDGRIPYPRPG 396

  Fly   375 QCGTSSIGHWLESS------------RYQLMDEAVQPIGAEPLYHS-----KLEQFGRLALDIIN 422
            .|.:.:....::|:            |:.:|.::|.|:...|.:..     :|.|   :.:|.:.
  Rat   397 TCPSKTYDPLIKSTRDFPDDVISFIRRHPVMYKSVYPVAGAPTFKRINVDYRLTQ---IVVDHVV 458

  Fly   423 TKTEQVHVLFVASS-GNHIKKLSVKYDGDGVQTCLVELWQADDTGTSSLLNMAYLKVSDSLYLGT 486
            .:..|..|:|:.:. |..:|.:|:..:...::..::|..|.....| ::|||........||:|:
  Rat   459 AEDGQYDVMFLGTDIGTVLKVVSISKEKWNMEEVVLEELQVFKHPT-AILNMELSLKQQQLYVGS 522

  Fly   487 DLALTRIPAQHCSRH-VSQSSCLNSMDPYCGWN 518
            ...|.::....|..: .:.:.|..:.||||.|:
  Rat   523 WDGLVQLSLHRCDTYGKACADCCLARDPYCAWD 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema5cNP_611293.3 Sema_5C 65..496 CDD:200526 142/478 (30%)
PSI 497..546 CDD:279745 7/23 (30%)
TSP1 556..607 CDD:214559
TSP1 610..663 CDD:214559
TSP1 674..725 CDD:214559
TSP1 802..834 CDD:214559
TSP1 853..901 CDD:214559
TSP1 906..953 CDD:214559
Sema3dNP_001098103.1 Sema_3D 61..534 CDD:200513 142/480 (30%)
PSI 533..570 CDD:214655 7/23 (30%)
Ig_Sema3 595..686 CDD:409455
Ig strand B 609..613 CDD:409455
Ig strand C 621..625 CDD:409455
Ig strand E 648..652 CDD:409455
Ig strand F 662..667 CDD:409455
Ig strand G 679..682 CDD:409455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.