DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema5c and Sema3c

DIOPT Version :9

Sequence 1:NP_611293.3 Gene:Sema5c / 37066 FlyBaseID:FBgn0284221 Length:1093 Species:Drosophila melanogaster
Sequence 2:NP_038685.3 Gene:Sema3c / 20348 MGIID:107557 Length:751 Species:Mus musculus


Alignment Length:527 Identity:145/527 - (27%)
Similarity:258/527 - (48%) Gaps:81/527 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 YISYQDLMSTAKRFY---DPETTWYSEMLFDVARNQVIVGARDTLYRMSFD---LEPLERASWGA 110
            |:::.:|..|....|   ..:...|..:|.|..::::.||::|.:..::.:   .|||. ..|.|
Mouse    30 YLTFDELRETKTSEYFSLSHQQLDYRILLMDEDQDRIYVGSKDHILSLNINNISQEPLS-VFWPA 93

  Fly   111 TPSEIAMCQAKGQS-ERWCRNYVRVLHSYGENQLYACGTNAFQPSCSW----RQMEN---LTVTG 167
            :..::..|:..|:. ...|.|:|||:.::....||.||:.||.|.|::    |:.|:   :..:.
Mouse    94 STIKVEECKMAGKDPTHGCGNFVRVIQTFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSK 158

  Fly   168 VDSGVVKCPFHPQANSTSLLQSNGQLFVGTATDFSGSDVAILRTGVESNKRFLRTKQYNNNWLSG 232
            .:||..:|.|:|..|:.|:: .|.:||.|...||.|:|.||.|:..:.|.  :||.|:|:.|||.
Mouse   159 CESGKGRCSFNPNVNTVSVM-INEELFSGMYIDFMGTDAAIFRSLTKRNA--VRTDQHNSKWLSE 220

  Fly   233 AQFV-------GSFEAGHFVYFLLRESAAEHMSCGKVIYSRVARVCKNDVGGGGQLLRDNWTSFL 290
            ..||       |:......|||..:|...::....|.|:|.:||:|.||.||...|: :.||:||
Mouse   221 PMFVDAHVIPDGTDPNDAKVYFFFKERLTDNNRSTKQIHSMIARICPNDTGGQRSLV-NKWTTFL 284

  Fly   291 KARLNCSLPGE--YPYYFDEIQGMTYAESE----SILYATFRTSGSSIFGSAVCAYNLSSINAAF 349
            ||||.||:..|  ...:|||::.:...|::    :::|..|.||.|...|||||.|:||.|...|
Mouse   285 KARLVCSVTDEDGPETHFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVF 349

  Fly   350 DGPFKQQEHSDAAWKTVNTNQRSQF-QCGTSSIGHWLESSR---------------YQLMDEAVQ 398
            :|||..:|..:  .:.::...|..: :.||...|.:..:.|               :.||..::.
Mouse   350 NGPFAHKEGPN--HQLISYQGRIPYPRPGTCPGGAFTPNMRTTKDFPDDVVTFIRNHPLMYNSIY 412

  Fly   399 PIGAEPL-------YHSKLEQFGRLALDIINTKTEQVHVLFVASSGNHIKKLSVKYDGDGVQTCL 456
            ||...||       |     ::.::|:|.:|....:.||||:.:....::|:.|..........|
Mouse   413 PIHRRPLIVRIGTDY-----KYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNSSASGEL 472

  Fly   457 V----ELWQADDTGTSSLLNMAYLKVS---DSLYLGTDLALTRIPAQHCSRHVSQSSCLN---SM 511
            :    |:::       :.:.:..:|:|   ..||:.::..::::....|  |:..::|.:   :.
Mouse   473 ILEELEVFK-------NHVPITTMKISSKKQQLYVSSNEGVSQVSLHRC--HIYGTACADCCLAR 528

  Fly   512 DPYCGWN 518
            ||||.|:
Mouse   529 DPYCAWD 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema5cNP_611293.3 Sema_5C 65..496 CDD:200526 134/487 (28%)
PSI 497..546 CDD:279745 8/25 (32%)
TSP1 556..607 CDD:214559
TSP1 610..663 CDD:214559
TSP1 674..725 CDD:214559
TSP1 802..834 CDD:214559
TSP1 853..901 CDD:214559
TSP1 906..953 CDD:214559
Sema3cNP_038685.3 Sema_3C 45..514 CDD:200512 133/487 (27%)
PSI 513..550 CDD:214655 8/25 (32%)
Ig_Semaphorin_classIII 575..664 CDD:143279
IG_like 579..653 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.