DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema5c and Sema3d

DIOPT Version :9

Sequence 1:NP_611293.3 Gene:Sema5c / 37066 FlyBaseID:FBgn0284221 Length:1093 Species:Drosophila melanogaster
Sequence 2:NP_083158.3 Gene:Sema3d / 108151 MGIID:1860118 Length:777 Species:Mus musculus


Alignment Length:575 Identity:169/575 - (29%)
Similarity:289/575 - (50%) Gaps:77/575 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNMLILKLPKMFSQ------LWLLLILSLLTLEGPQPSTGSGYTTKSSVDLLENDSRYISYQDLM 59
            ||:...:.|:..||      .|::||:::|.|    |.|   .|:|.::..|:     ::|:||:
Mouse     1 MNVTKDENPRSRSQDLHLFHAWMMLIMTVLFL----PVT---ETSKQNIPRLK-----LTYKDLL 53

  Fly    60 --STAKRFY-DPETTWYSEMLFDVARNQVIVGARDTLYRMSF-DL-EPLERASWGATPSEIAMCQ 119
              :|...|. ..|...:..:|.|..|..:::||:|.::.:|. || :..::..|.|....:.:|:
Mouse    54 LSNTCIPFLGSSEGLDFQTLLLDEERGILLLGAKDHVFLLSLVDLNKNFKKIYWPAAKERVELCK 118

  Fly   120 AKGQ-SERWCRNYVRVLHSYGENQLYACGTNAFQPSCSWRQME--------NLTVTGVDSGVVKC 175
            ..|: :...|.|::|||..|.:..:|.|||.||.|.|.:..:.        .|....::||.:||
Mouse   119 LAGKDANAECANFIRVLQPYNKTHVYVCGTGAFHPLCGYIDLGANKEELIFKLDTHNLESGRLKC 183

  Fly   176 PFHPQANSTSLLQSNGQLFVGTATDFSGSDVAILRT-GVESNKRFLRTKQYNNNWLSGAQFVGSF 239
            ||.||....|:: ::..|:.|||:||.|.|.|..|: |:..:...:||....::||:||:|:|:|
Mouse   184 PFDPQQPFASVM-TDEHLYSGTASDFLGKDTAFTRSLGLMQDHHSIRTDISEHHWLNGAKFIGTF 247

  Fly   240 EA-------GHFVYFLLRESAAEHMSCGKVIYSRVARVCKNDVGGGGQLLRDNWTSFLKARLNCS 297
            ..       ...:||..|||:.|..:..:.|.|||.|||||||||...|: :.||:||||||.||
Mouse   248 PIPDTYNPDDDKIYFFFRESSQEGSTSDRSILSRVGRVCKNDVGGQRSLI-NKWTTFLKARLICS 311

  Fly   298 LPGE--YPYYFDEIQGM----TYAESESILYATFRTSGSSIFGSAVCAYNLSSINAAFDGPFKQQ 356
            :||.  ...:|||:|.:    |..|...::|..|.|:.|...|||||.|:::.|.|.|:||:..:
Mouse   312 IPGSDGADTHFDELQDIYLLPTRDERNPVVYGVFTTTSSIFKGSAVCVYSMADIRAVFNGPYAHK 376

  Fly   357 EHSDAAWKTVNTNQRSQF----QCGTSSIGHWLESS------------RYQLMDEAVQPIGAEPL 405
            |.:|..|  |..:.|..:    .|.:.:....::|:            |:.:|.::|.|:...|.
Mouse   377 ESADHRW--VQYDGRIPYPRPGTCPSKTYDPLIKSTRDFPDDVISFIRRHPVMYKSVYPVAGAPT 439

  Fly   406 YHS-----KLEQFGRLALDIINTKTEQVHVLFVASS-GNHIKKLSVKYDGDGVQTCLVELWQADD 464
            :..     :|.|   :.:|.:..:..|..|:|:.:. |..:|.:|:..:...::..::|..|...
Mouse   440 FKRINVDYRLTQ---IVVDHVVAEDGQYDVMFLGTDIGTVLKVVSISKEKWNMEEVVLEELQVFK 501

  Fly   465 TGTSSLLNMAYLKVSDSLYLGTDLALTRIPAQHCSRH-VSQSSCLNSMDPYCGWN 518
            ..| ::|||........||:|:...|.::....|..: .:.:.|..:.||||.|:
Mouse   502 HPT-AILNMELSLKQQQLYVGSWDGLVQLSLHRCDTYGKACADCCLARDPYCAWD 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema5cNP_611293.3 Sema_5C 65..496 CDD:200526 143/478 (30%)
PSI 497..546 CDD:279745 7/23 (30%)
TSP1 556..607 CDD:214559
TSP1 610..663 CDD:214559
TSP1 674..725 CDD:214559
TSP1 802..834 CDD:214559
TSP1 853..901 CDD:214559
TSP1 906..953 CDD:214559
Sema3dNP_083158.3 Sema_3D 61..534 CDD:200513 143/480 (30%)
PSI 533..570 CDD:214655 7/23 (30%)
Ig_Semaphorin_classIII 596..686 CDD:143279
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 740..777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.