DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema5c and SEMA3C

DIOPT Version :9

Sequence 1:NP_611293.3 Gene:Sema5c / 37066 FlyBaseID:FBgn0284221 Length:1093 Species:Drosophila melanogaster
Sequence 2:NP_001337049.1 Gene:SEMA3C / 10512 HGNCID:10725 Length:769 Species:Homo sapiens


Alignment Length:523 Identity:144/523 - (27%)
Similarity:254/523 - (48%) Gaps:73/523 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 YISYQDLMSTAKRFY---DPETTWYSEMLFDVARNQVIVGARDTLYRMSFDLEPLERAS--WGAT 111
            |:::.:|..|....|   ......|..:|.|..::::.||::|.:..::.:....|..|  |.|:
Human    48 YLTFDELRETKTSEYFSLSHHPLDYRILLMDEDQDRIYVGSKDHILSLNINNISQEALSVFWPAS 112

  Fly   112 PSEIAMCQAKGQS-ERWCRNYVRVLHSYGENQLYACGTNAFQPSCSW----RQMEN---LTVTGV 168
            ..::..|:..|:. ...|.|:|||:.::....||.||:.||.|.|::    |:.|:   :..:..
Human   113 TIKVEECKMAGKDPTHGCGNFVRVIQTFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKC 177

  Fly   169 DSGVVKCPFHPQANSTSLLQSNGQLFVGTATDFSGSDVAILRTGVESNKRFLRTKQYNNNWLSGA 233
            :||..:|.|:|..|:.|:: .|.:||.|...||.|:|.||.|:..:.|.  :||.|:|:.|||..
Human   178 ESGKGRCSFNPNVNTVSVM-INEELFSGMYIDFMGTDAAIFRSLTKRNA--VRTDQHNSKWLSEP 239

  Fly   234 QFV-------GSFEAGHFVYFLLRESAAEHMSCGKVIYSRVARVCKNDVGGGGQLLRDNWTSFLK 291
            .||       |:......|||..:|...::....|.|:|.:||:|.||.||...|: :.||:|||
Human   240 MFVDAHVIPDGTDPNDAKVYFFFKEKLTDNNRSTKQIHSMIARICPNDTGGLRSLV-NKWTTFLK 303

  Fly   292 ARLNCSLPGE--YPYYFDEIQGMTYAESE----SILYATFRTSGSSIFGSAVCAYNLSSINAAFD 350
            |||.||:..|  ...:|||::.:...|::    :::|..|.||.|...|||||.|:||.|...|:
Human   304 ARLVCSVTDEDGPETHFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFN 368

  Fly   351 GPFKQQEHSDAAWKTVNTNQRSQF-QCGTSSIGHWLESSR---------------YQLMDEAVQP 399
            |||..:|..:  .:.::...|..: :.||...|.:..:.|               :.||..::.|
Human   369 GPFAHKEGPN--HQLISYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYP 431

  Fly   400 IGAEPL-------YHSKLEQFGRLALDIINTKTEQVHVLFVASSGNHIKKLSVKYDGDGVQTCLV 457
            |...||       |     ::.::|:|.:|....:.||||:.:....::|:.|....:.|...|:
Human   432 IHKRPLIVRIGTDY-----KYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNNSVSGELI 491

  Fly   458 ----ELWQADDTGTSSLLNMAYLKVSDSLYLGTDLALTRIPAQHCSRHVSQSSCLN---SMDPYC 515
                |:::    ..:.:..|........||:.::..::::....|  |:..::|.:   :.||||
Human   492 LEELEVFK----NHAPITTMKISSKKQQLYVSSNEGVSQVSLHRC--HIYGTACADCCLARDPYC 550

  Fly   516 GWN 518
            .|:
Human   551 AWD 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema5cNP_611293.3 Sema_5C 65..496 CDD:200526 133/483 (28%)
PSI 497..546 CDD:279745 8/25 (32%)
TSP1 556..607 CDD:214559
TSP1 610..663 CDD:214559
TSP1 674..725 CDD:214559
TSP1 802..834 CDD:214559
TSP1 853..901 CDD:214559
TSP1 906..953 CDD:214559
SEMA3CNP_001337049.1 Sema_3C 63..532 CDD:200512 132/483 (27%)
PSI 531..568 CDD:214655 8/25 (32%)
Ig_Semaphorin_classIII 593..682 CDD:143279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.