DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stau and PRKRA

DIOPT Version :9

Sequence 1:NP_476751.1 Gene:stau / 37065 FlyBaseID:FBgn0003520 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_003681.1 Gene:PRKRA / 8575 HGNCID:9438 Length:313 Species:Homo sapiens


Alignment Length:480 Identity:101/480 - (21%)
Similarity:155/480 - (32%) Gaps:177/480 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   540 LQQAKHDAAARALQVLKTQAISASEEALEDSMDEGDKKSPISQVHEIGIK-RNMTVHFKVLREEG 603
            :.|::|.|.|..|:...:...|     |...:.....|:||..:||.|:| :|:.| ::..|.:.
Human     1 MSQSRHRAEAPPLEREDSGTFS-----LGKMITAKPGKTPIQVLHEYGMKTKNIPV-YECERSDV 59

  Fly   604 PAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKLPPLTPTKQTPLKRIKVKTPGKS 668
            ..|:..|.....||.|...|||..||::|.||||..:..|                       |:
Human    60 QIHVPTFTFRVTVGDITCTGEGTSKKLAKHRAAEAAINIL-----------------------KA 101

  Fly   669 GAAAREGSVVSGTDGPTQTGKPERRKRLNPPKDKLIDMDDADNPITKLIQLQQTRKEKEPIFELI 733
            .|     |:......|..   |:..|:   ||::|       |||..|.:|......:.|.:.|.
Human   102 NA-----SICFAVPDPLM---PDPSKQ---PKNQL-------NPIGSLQELAIHHGWRLPEYTLS 148

  Fly   734 AKNGNETARRREFVMEVSASGSTARGTGNSKKLAKRNAAQALFELLEAVQVTPTNETQSSEECST 798
            .:.|  .|.:||:............|.|.|||.||||||:..  |.:...::|.|....      
Human   149 QEGG--PAHKREYTTICRLESFMETGKGASKKQAKRNAAEKF--LAKFSNISPENHISL------ 203

  Fly   799 SATMSAVTAPAVEATAEGKVPMVATPVGPMPGILILRQNKKPAKKRDQIVIVKSNVESKEEEANK 863
                                                                             
Human   204 ----------------------------------------------------------------- 203

  Fly   864 EVAVAAEENSNNSANSGDSSNSSSGDSQATEAASESALNTSTGSNTSGVSSNSSNVGANTDGNNH 928
                                                   |:...::.|.:.:|..       |:.
Human   204 ---------------------------------------TNVVGHSLGCTWHSLR-------NSP 222

  Fly   929 AESKNNTESSSNSTSNTQSAGVHMKEQLL-YLSKLLDFEVNFSDYPKGNHN-EFLTIVTLSTHPP 991
            .|..|..:.|..|..||...      ||| .::|...|.:.:.|..:.:.| ::..:..|||.|.
Human   223 GEKINLLKRSLLSIPNTDYI------QLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSPI 281

  Fly   992 QICHGVGKSSEESQNDAASNALKIL 1016
            .:|||.|.|...:|:|||.|||:.|
Human   282 TVCHGSGISCGNAQSDAAHNALQYL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stauNP_476751.1 DSRM 312..375 CDD:214634
DSRM <529..555 CDD:294045 5/14 (36%)
DSRM 579..644 CDD:214634 24/65 (37%)
DSRM 712..780 CDD:214634 22/67 (33%)
Staufen_C <953..1020 CDD:293091 24/66 (36%)
PRKRANP_003681.1 Sufficient for self-association and interaction with TARBP2 1..103 34/130 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 5/19 (26%)
DSRM_PRKRA_rpt1 32..102 CDD:380718 27/93 (29%)
Sufficient for self-association and interaction with TARBP2 102..195 31/114 (27%)
DSRM_PRKRA_rpt2 126..192 CDD:380720 23/69 (33%)
Sufficient for self-association and interaction with TARBP2 195..313 36/235 (15%)
DSRM_PRKRA_rpt3 239..310 CDD:380721 25/74 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3732
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.