DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stau and Adarb1

DIOPT Version :9

Sequence 1:NP_476751.1 Gene:stau / 37065 FlyBaseID:FBgn0003520 Length:1026 Species:Drosophila melanogaster
Sequence 2:XP_006256337.1 Gene:Adarb1 / 25367 RGDID:2033 Length:775 Species:Rattus norvegicus


Alignment Length:584 Identity:113/584 - (19%)
Similarity:177/584 - (30%) Gaps:221/584 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 NSTSNSTVIASEPVTQEDTSQKPETRQEPASADD-HVSTGNIDATGALSNEDTSSSGRGGKDK-- 310
            |.:|:||.:..   .:...:..|:....|...:. .:|.|   ..|:.|.:.....|..|..|  
  Rat    72 NMSSSSTDVKE---NRNLDNMPPKDSSTPGPGEGIPLSNG---GGGSTSRKRPLEEGSNGHSKYR 130

  Fly   311 --------TPMCLVNELARYNKITH--QYRLTEERGPAHCKTFTVTLMLGDEEYSADGFKIKKAQ 365
                    .|:...|.|.:.|:|..  ||.|..:.||.|...|.:::.:..:.:...|...|||:
  Rat   131 LKKRRKTPGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAK 195

  Fly   366 HLAASKAIEETMYKHPPPKIRRSEEGGPMRTHITPTVELNALAMKLGQRTFYLLDPTQIPPT--- 427
            ..||.||: .:..:.|    ..||      .|:       |:...|...|.:..|....|.|   
  Rat   196 LHAAEKAL-RSFVQFP----NASE------AHL-------AMGRTLSVNTDFTSDQADFPDTLFN 242

  Fly   428 -----DSIVPPEFAGGH------------LLTAPGP-GMPQPPPPPAYALRQRLGNGFVPIPSQP 474
                 |...||.:.|.:            |..:|.| .:.|||               :|||.  
  Rat   243 GFETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPVPASLTQPP---------------LPIPP-- 290

  Fly   475 MHPHFFHGPGQRPFPPKFPSRFALPPPLGAHVHHGPNGPFPSVPTPPSKITLFVGKQKFVGIGRT 539
                        ||||                   |:|                           
  Rat   291 ------------PFPP-------------------PSG--------------------------- 297

  Fly   540 LQQAKHDAAARALQVLKTQAISASEEALEDSMDEGDKKSPISQVHEI--GIKRNMTVHFKVLREE 602
                                                 |:|:..::|:  |:|      :..|.|.
  Rat   298 -------------------------------------KNPVMILNELRPGLK------YDFLSES 319

  Fly   603 GPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKML--------------------------- 640
            |.:|.|:|:.:.:|.....||.|..||::|.|||:..|                           
  Rat   320 GESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHLDQTPSRQPVLSEGLQLHLP 384

  Fly   641 ---------VELQKLPPLTPTKQTPLKRIK-----VKTPGKSGAAAREGSVVSGTDGPTQTGKPE 691
                     :.|.|...||....:|..|.|     |.|.|.....|:..||.:||.........:
  Rat   385 QVLADAVSRLVLGKFSDLTDNFSSPHARRKVLSGVVMTTGTDVKDAKVISVSTGTKCINGEYMSD 449

  Fly   692 RRKRLNPPKDKLIDMDDADNPITKLIQLQQTRKE--KEPIFELIAKNGNETARRREFVMEVSAS 753
            |...||....::|........:...::|....||  |:.||:...:.|.......:|.:.:|.|
  Rat   450 RGLALNDCHAEIISRRSLLRFLYAQLELYLNNKEDQKKSIFQKSERGGFRLKDTVQFHLYISTS 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stauNP_476751.1 DSRM 312..375 CDD:214634 20/64 (31%)
DSRM <529..555 CDD:294045 0/25 (0%)
DSRM 579..644 CDD:214634 21/102 (21%)
DSRM 712..780 CDD:214634 10/44 (23%)
Staufen_C <953..1020 CDD:293091
Adarb1XP_006256337.1 DSRM 143..206 CDD:238007 19/63 (30%)
DSRM 299..357 CDD:238007 20/63 (32%)
ADEAMc 386..772 CDD:214718 29/128 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.