DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5098 and Phf6

DIOPT Version :9

Sequence 1:NP_001261066.1 Gene:CG5098 / 37063 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_081918.1 Gene:Phf6 / 70998 MGIID:1918248 Length:364 Species:Mus musculus


Alignment Length:227 Identity:48/227 - (21%)
Similarity:80/227 - (35%) Gaps:46/227 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1085 GPYLVTSDCDEYRAAVQTPGAQDIDGMFVNKRRREDMVKGQERNLPAVPATLANIMQAPKISMHK 1149
            |.|:|.  |.:::.......| |::..|..........|.::::....|.. .|:...|:.|...
Mouse   122 GIYMVY--CRKHKKTAHNSEA-DLEESFNEHELEPSSPKTKKKSRKGRPRK-TNLKGLPEDSRST 182

  Fly  1150 RKRKQTHDSSISYSD------DPNESRSQCSSVDLLDCSTESKFVETFRGMGKTS-ENGFEVWLH 1207
            .........|.||.|      .||::|.:|....:.:...|::        ||.. .|..:...|
Mouse   183 SSHGTDEMESSSYRDRSPHRSSPNDTRPKCGFCHVGEEENEAR--------GKLHIFNAKKAAAH 239

  Fly  1208 EDCAVWSN----------------DIHLIGAHVNGLDAAVWDSTRYQCVLCQQTGASICCFQRCC 1256
            ..|.::|:                ||..:...:.       ...|.:|.||.|.||:|.|..:.|
Mouse   240 YKCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIK-------RGKRMKCTLCSQPGATIGCEIKAC 297

  Fly  1257 KAAAHVPCG--RSANW--SLSEEDRKVYCHLH 1284
            ....|..||  ..|.:  ::|....|:||..|
Mouse   298 VKTYHYHCGVQDKAKYIENMSRGIYKLYCKNH 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 47/225 (21%)
Phf6NP_081918.1 Nuclear localization signal. /evidence=ECO:0000255 13..16
Extended PHD1 domain (ePHD1). /evidence=ECO:0000255|PROSITE-ProRule:PRU01146 14..132 4/11 (36%)
ePHD1_PHF6 17..131 CDD:277180 4/10 (40%)
Nuclear localization signal. /evidence=ECO:0000255 129..133 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..211 15/73 (21%)
Nucleolar localization signal. /evidence=ECO:0000255 157..169 2/11 (18%)
Extended PHD2 domain (ePHD2). /evidence=ECO:0000255|PROSITE-ProRule:PRU01146 209..330 30/136 (22%)
ePHD2_PHF6 212..329 CDD:277181 28/131 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 330..364 48/227 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.