DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5098 and Phf11c

DIOPT Version :9

Sequence 1:NP_001261066.1 Gene:CG5098 / 37063 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_001157761.1 Gene:Phf11c / 628705 MGIID:3648476 Length:339 Species:Mus musculus


Alignment Length:140 Identity:27/140 - (19%)
Similarity:47/140 - (33%) Gaps:46/140 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1207 HEDCAVWSNDIHLIGAH----------VNGLDAAVWDSTRYQCVLCQQTGASICCFQRCCKAAAH 1261
            ||:|.::|:.:....||          |..:...:|..:...|..|...||.:.|.:..|....|
Mouse    71 HENCLLYSSGLVECEAHNPCKIARNVDVKSVLERIWRGSTMICSFCNNEGAIVRCGETSCAKNYH 135

  Fly  1262 VPCGRSANWSLSE----EDRKVYCHLHRHEPGVVEPIKTESIAPVEVSVATPPAPAP-------- 1314
            :.|.:. ::::.:    ...|::|..|                |.:...||..|..|        
Mouse   136 LFCAKE-DYAVLQGGVTRTYKLFCPEH----------------PPQQEEATESADGPSMKRKRGR 183

  Fly  1315 -------PPA 1317
                   |||
Mouse   184 KKRLSSGPPA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 18/90 (20%)
Phf11cNP_001157761.1 PHD_SF 48..161 CDD:304600 18/90 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.