DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5098 and pie

DIOPT Version :9

Sequence 1:NP_001261066.1 Gene:CG5098 / 37063 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_001260348.1 Gene:pie / 44315 FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster


Alignment Length:382 Identity:89/382 - (23%)
Similarity:139/382 - (36%) Gaps:104/382 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 KKQRQA---LLQRNLTEQHRMQQDDEPPKNHTSPAMPPPSPQSNSSS----SSSSSSSANTHSSQ 654
            :|||.|   |.:|||       :.|:|      ..:.|.....|..|    ..||.::.:.|...
  Fly   209 EKQRNAYRELHERNL-------KCDQP------NCLCPSGRTYNRLSWVILCCSSCAATSAHLKC 260

  Fly   655 SSHAVNNIPKPEINNKATTDTPASPALVEQGDIDAKPAVSVHECDEEEEPAVN---KVSPAHPDP 716
            ...|: .:||    .:..||...|..|..:..|...||.:..|.:.:.:..|:   .|....||.
  Fly   261 LVGAL-RLPK----KRERTDFKCSMCLDVERRIAEGPARTTEETNADGDNQVDGSFYVQKLGPDA 320

  Fly   717 PTTAAVAAPPATESPKK----------SSPAANSESCPFGEVEDKL------EQMFAGIEEETER 765
            .|.:....|..:|..:.          |.|.:|:.|       ::|      |:|...|.:..| 
  Fly   321 ATRSLTQTPVFSEEDESERSSNITVIFSQPKSNATS-------ERLSLSPPQEEMIVEIPDSPE- 377

  Fly   766 ISSPEKPAEE--SAAMVAHNLTAQ--LALDPSKTLDTPAENQTSVLAVLAPNQTPTPEIRPVATK 826
             :||:...:|  |...:|...|:.  ..:..|:..|:|.....|.:..|.  ||....:.|..|:
  Fly   378 -ASPKTSIDENHSPQPIARRDTSDSPQPIAASEIPDSPQPTAASEIPDLP--QTTAINVNPELTQ 439

  Fly   827 AAMKSTMPSPVHSPIPQSRSTSTPLVAGDDSKSNTPVP-----AKAP----APRRPPPRRL---- 878
            ....:|:|   |||.|:: |.||.||:   ...:.|.|     ||||    .|:..|...|    
  Fly   440 QTALNTIP---HSPQPEA-SFSTQLVS---QTFDCPQPQEQAVAKAPNSPSLPKEDPNTLLVLKS 497

  Fly   879 ---------------------SMG--MDASLLRFMIDDPPAKKPGRK--KKVTKEPD 910
                                 .||  :...:|||..|||..:...:.  ::|...||
  Fly   498 GFQCPGEPFFYLVIYEFEHGTCMGECIGTCVLRFKEDDPRIQDTSQAALERVNITPD 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600
pieNP_001260348.1 PHD_SF 9..117 CDD:304600
PHD_SF 224..>260 CDD:304600 8/41 (20%)
PARM 318..>491 CDD:293666 48/190 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.