DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5098 and g2e3

DIOPT Version :9

Sequence 1:NP_001261066.1 Gene:CG5098 / 37063 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_001003822.1 Gene:g2e3 / 368848 ZFINID:ZDB-GENE-030616-400 Length:706 Species:Danio rerio


Alignment Length:109 Identity:27/109 - (24%)
Similarity:44/109 - (40%) Gaps:32/109 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1177 DLLDCSTESKFVETFRGMGKTSENGFEVW------------LHEDCAVWSN--------DIHLIG 1221
            ||:.|            :.|.|||..|.:            :|..|.:.|:        |..:.|
Zfish    17 DLICC------------LCKRSENNKEKYGEKVHLEQHNLAVHFFCLLMSSGICQRGEEDEDVYG 69

  Fly  1222 AHVNGLDAAVWDSTRYQCVLCQQTGASICCFQRCCKAAAHVPCG 1265
            ..|..:...:..|:|.:|..|::.|||:.|..:.|:...|:|||
Zfish    70 FLVGDIKKEIRRSSRLRCFHCKKAGASVGCSIKSCRQMVHMPCG 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 27/109 (25%)
g2e3NP_001003822.1 ePHD_PHF7_G2E3_like 20..133 CDD:277139 25/106 (24%)
PHD_PHF7_G2E3_like 237..290 CDD:276971
HECTc 433..695 CDD:294058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.