DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5098 and Phf7

DIOPT Version :9

Sequence 1:NP_001261066.1 Gene:CG5098 / 37063 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_001259740.1 Gene:Phf7 / 33015 FlyBaseID:FBgn0031091 Length:520 Species:Drosophila melanogaster


Alignment Length:386 Identity:80/386 - (20%)
Similarity:125/386 - (32%) Gaps:117/386 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   738 ANSE----SCPFGEVEDKLEQM----FAGIEEETERISSPEKPAEESAAMVAHNLTAQLALDPSK 794
            |||.    .||.....|...::    .|.::::....:.|:..|.:....|  |.||.|.:..|.
  Fly   171 ANSSGYFFKCPLCNNTDVFRRVAYMGIAVLDQDASWETEPDAFAGQYRRDV--NCTAALCVAVSG 233

  Fly   795 TLDTPA---------ENQTSVLAVLAPNQTPTPEIRPVATKAAMKSTMPSPVHSPIPQSRSTSTP 850
            ..||.|         .|.:..|..|...|....::....:..|            :|.:.|.|..
  Fly   234 RADTSAMLLYCTSCGANPSHYLCTLKTLQNYVCKVCSAVSPEA------------VPVAESDSDD 286

  Fly   851 LVAGDDSKSNTPVPAKAPAP----------RRPPPRRLSMGMDASLLRFMIDDPPAKKPGRKKKV 905
            ..:.|||       |:||.|          :..|......|..        ||....:.....||
  Fly   287 AGSMDDS-------AEAPRPGHLNGDQIQEKLSPSHWDDFGSS--------DDDAVFQRAFDTKV 336

  Fly   906 TKEPDFEDDDKPSTSAAAAAALAARQ-------------LSEAASATKSKPAAGAKKKNAGVKGK 957
            ........||:|||| |.|.|||.|.             ||...::.:|..|......:......
  Fly   337 QSRVVTLSDDQPSTS-AGARALADRGTRTFESQGTQTTFLSSVVTSFRSATATATSSTSTSTSTS 400

  Fly   958 KGSA-GKGNAKNAKQNGKKSARKPAFT--------TDEDS---------------TP---APTNG 995
            ..:. .:.|.:.:..||::..| |.:.        :|:||               ||   ||:||
  Fly   401 ASTLDNQENTEPSTSNGRRPWR-PRYVSPPRHVSDSDDDSDEYDSDEYESKRRQLTPTAAAPSNG 464

  Fly   996 GGSVPELRFKSPFILIKPDGSVSIKNTHSAEDVNEKQTKVKKAPHERKNLRGMHSSTLSNR 1056
            ...:               ||:|.:.:..|..|..::|...:.    .:|..|..|.::||
  Fly   465 RRLL---------------GSISPEPSTPAPRVLRRRTLANRP----SSLANMDISCVANR 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600
Phf7NP_001259740.1 ePHD_PHF7_G2E3_like 5..116 CDD:277139
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.