DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5098 and Phf6

DIOPT Version :9

Sequence 1:NP_001261066.1 Gene:CG5098 / 37063 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_008771882.1 Gene:Phf6 / 100359714 RGDID:2323526 Length:364 Species:Rattus norvegicus


Alignment Length:273 Identity:53/273 - (19%)
Similarity:78/273 - (28%) Gaps:99/273 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1021 NTHSAEDVNEKQTKVKKAPHERK-NLRGMHSSTLSNRYDADTTDSTWICVFCKRGPHKLGLGDLF 1084
            |.|..|..:.|..|..:....|| ||:|:...|.|.  .:..||.|....:..|.||:....|  
  Rat   147 NEHELEPSSPKTKKKSRKGRPRKTNLKGLAEDTRST--SSHGTDETESSSYRDRSPHRSSPND-- 207

  Fly  1085 GPYLVTSDCDEYRAAVQTPGAQDIDGMFVNKRRREDMVKGQERNLPAVPATLANIMQAPKISMHK 1149
                ....|.                 |.:....|:..:|                   |:.:..
  Rat   208 ----TRPKCG-----------------FCHVGEEENEARG-------------------KLHIFN 232

  Fly  1150 RKRKQTHDSSISYSDD----PNESRSQCSSVDLLDCSTESKFVETFRGMGKTSENGFEVWLHEDC 1210
            .|:...|...:.:|..    ...||::....|:.....|.|     ||                 
  Rat   233 AKKAAAHYKCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIK-----RG----------------- 275

  Fly  1211 AVWSNDIHLIGAHVNGLDAAVWDSTRYQCVLCQQTGASICCFQRCCKAAAHVPCG--RSANW--S 1271
                                    .|.:|.||.|.||:|.|..:.|....|..||  ..|.:  :
  Rat   276 ------------------------KRMKCTLCSQPGATIGCEIKACVKTYHYHCGVQDKAKYIEN 316

  Fly  1272 LSEEDRKVYCHLH 1284
            :|....|:||..|
  Rat   317 MSRGIYKLYCKNH 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 37/223 (17%)
Phf6XP_008771882.1 ePHD1_PHF6 17..131 CDD:277180
ePHD2_PHF6 212..329 CDD:277181 33/198 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.