DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5757 and yghS

DIOPT Version :10

Sequence 1:NP_611290.3 Gene:CG5757 / 37062 FlyBaseID:FBgn0034299 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_417459.1 Gene:yghS / 947476 ECOCYCID:G7551 Length:237 Species:Escherichia coli


Alignment Length:113 Identity:31/113 - (27%)
Similarity:49/113 - (43%) Gaps:24/113 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIIFEGCDRSGKTTQSRLLVELLKSKGIPTLPMNFPERSSSIGQVINS----------YL----- 58
            :|...|||.|||:|.:..||..|.:: :||..:...:.|..||:.|:.          ||     
E. coli    16 VIAIVGCDGSGKSTLTASLVNELAAR-MPTEHIYLGQSSGRIGEWISQLPVIGAPFGRYLRSKAA 79

  Fly    59 -------TNSKDLPDEVIHLMFSANRWEHINQVKEKLLEGTTLVVDRY 99
                   |...::...||:|: |..|.....::..|..:|..|:.|||
E. coli    80 HVHEKPSTPPGNITALVIYLL-SCWRAYKFRKMLCKSQQGFLLITDRY 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5757NP_611290.3 NK 1..197 CDD:450170 31/113 (27%)
yghSNP_417459.1 TMPK 15..234 CDD:238835 31/113 (27%)

Return to query results.
Submit another query.