DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5757 and cmpk2

DIOPT Version :9

Sequence 1:NP_001261065.1 Gene:CG5757 / 37062 FlyBaseID:FBgn0034299 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_699055.5 Gene:cmpk2 / 570478 ZFINID:ZDB-GENE-040724-24 Length:414 Species:Danio rerio


Alignment Length:187 Identity:50/187 - (26%)
Similarity:74/187 - (39%) Gaps:51/187 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIIFEGCDRSGKTTQSRLLVELLKS---KGIPTLPMNFPERSSSIGQVI-------NSYLTNSKD 63
            :|:.||.|.:||||.:..|.:.|.:   |..|.....|.:|..|...:|       .:|:|.:  
Zfish   220 VIVIEGLDATGKTTLTEALRQSLNATLLKSPPQCLAPFRQRFDSEPPLIRRAFYALGNYITAT-- 282

  Fly    64 LPDEVIHLMFSANRWEHINQVKEKLLEGTTLVVDRYSFSGVAYSAAKGL----------DFDWCY 118
                            ||  .||.|  ...::||||..|..||:.|..:          |.:...
Zfish   283 ----------------HI--AKESL--RAPVIVDRYWHSTAAYAIATAVGGRVENLPKPDSELYV 327

  Fly   119 APERGLIKPDAVFYLRAPPND----LTHRGQYGKERYEKVE----FQGRVAEVFNRI 167
            .|| .|::||.|..|...|.:    |..|||.......::|    |:.:|.|.:.||
Zfish   328 WPE-DLLQPDLVLLLTVSPEERVRRLRDRGQDKTTEEAELEINQLFRLKVEEAYKRI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5757NP_001261065.1 PLN02924 1..197 CDD:178512 50/187 (27%)
Thymidylate_kin 12..191 CDD:280400 49/184 (27%)
cmpk2XP_699055.5 Tmk 221..410 CDD:223203 50/186 (27%)
NK 221..409 CDD:302627 50/186 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0125
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.