DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5757 and dtymk

DIOPT Version :9

Sequence 1:NP_001261065.1 Gene:CG5757 / 37062 FlyBaseID:FBgn0034299 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001032187.1 Gene:dtymk / 567734 ZFINID:ZDB-GENE-990603-11 Length:212 Species:Danio rerio


Alignment Length:207 Identity:90/207 - (43%)
Similarity:132/207 - (63%) Gaps:1/207 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KRGALIIFEGCDRSGKTTQSRLLVELLKSKGIPTLPMNFPERSSSIGQVINSYLTNSKDLPDEVI 69
            :|||||:.||.||:|||||.:.||:.::..|.....|.||:|::.|||:|:|||....:|.|..:
Zfish     4 RRGALIVLEGVDRAGKTTQCQKLVQAIQQSGRAAEIMRFPDRTTKIGQLISSYLEKKSNLEDHTV 68

  Fly    70 HLMFSANRWEHINQVKEKLLEGTTLVVDRYSFSGVAYSAAK-GLDFDWCYAPERGLIKPDAVFYL 133
            ||:|||||||.:..:|:||.||..||||||:|||||:::|| |...:||..|:.||.|||.|.:|
Zfish    69 HLLFSANRWEMVPVMKQKLEEGINLVVDRYAFSGVAFTSAKPGFSLEWCMNPDVGLPKPDLVMFL 133

  Fly   134 RAPPNDLTHRGQYGKERYEKVEFQGRVAEVFNRICSKEGSYFHQFDARQSVEDLHAQIASITEEL 198
            :..||...:||:||.||||...||..|.:.|..:.......:...||.:::|::|..|..::|.:
Zfish   134 QLNPNVAANRGEYGNERYETSAFQRTVQQRFEELMQDTSINWKVIDAARTIEEVHKDIKDLSENI 198

  Fly   199 LPKVATRPLDTL 210
            :.....:|:..|
Zfish   199 ISLAEEQPVGEL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5757NP_001261065.1 PLN02924 1..197 CDD:178512 87/192 (45%)
Thymidylate_kin 12..191 CDD:280400 81/179 (45%)
dtymkNP_001032187.1 PLN02924 5..211 CDD:178512 90/206 (44%)
Thymidylate_kin 11..191 CDD:280400 81/179 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596190
Domainoid 1 1.000 167 1.000 Domainoid score I3816
eggNOG 1 0.900 - - E1_COG0125
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6285
Inparanoid 1 1.050 185 1.000 Inparanoid score I3932
OMA 1 1.010 - - QHG54297
OrthoDB 1 1.010 - - D1259751at2759
OrthoFinder 1 1.000 - - FOG0003433
OrthoInspector 1 1.000 - - oto41206
orthoMCL 1 0.900 - - OOG6_100714
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R645
SonicParanoid 1 1.000 - - X2795
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.700

Return to query results.
Submit another query.