DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5757 and Cmpk2

DIOPT Version :9

Sequence 1:NP_001261065.1 Gene:CG5757 / 37062 FlyBaseID:FBgn0034299 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_065582.3 Gene:Cmpk2 / 22169 MGIID:99830 Length:447 Species:Mus musculus


Alignment Length:207 Identity:47/207 - (22%)
Similarity:82/207 - (39%) Gaps:36/207 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIIFEGCDRSGKTTQSRLLVELLKSKGIPTLPMNFPERSSSIGQVINSYLTNSKDLPDEVIHLMF 73
            :|..||.|.:||||.::.:.|.||:..:.:.|           ..|:.:.....|.|..:....:
Mouse   254 VIAIEGLDATGKTTLTQSVSESLKAVLLQSPP-----------PCISQWRKIFDDEPTIIRRAFY 307

  Fly    74 SANRWEHINQVKEKLLEGTT--LVVDRYSFSGVAYSAAKGLDFDWCYAPER---------GLIKP 127
            |...:...:::.:   |.|.  ::||||..|...|:.|..:.....|.|..         .|:||
Mouse   308 SLGNYLVASEIAK---ESTNFPVIVDRYWHSTATYAIATEVSGGLQYLPPAHHPVYQWPGDLLKP 369

  Fly   128 DAVFYLRAPPND----LTHRGQYGKERYEKVE----FQGRVAEVFNRICSKEGSYFHQFDARQSV 184
            |.|..|.....:    |..|||...:...::|    |:.:|...:.|:   |....|..||..|.
Mouse   370 DLVLLLTVNSEERVRRLQGRGQEKTKEEAELEANNVFRQKVEMTYQRM---ENPSCHLVDASPSR 431

  Fly   185 EDLHAQIASITE 196
            |.:..::..:.:
Mouse   432 ETVLQKVLELIQ 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5757NP_001261065.1 PLN02924 1..197 CDD:178512 47/207 (23%)
Thymidylate_kin 12..191 CDD:280400 46/197 (23%)
Cmpk2NP_065582.3 Tmk 248..443 CDD:223203 47/205 (23%)
NK 255..444 CDD:302627 47/206 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0125
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.