DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5757 and Dtymk

DIOPT Version :9

Sequence 1:NP_001261065.1 Gene:CG5757 / 37062 FlyBaseID:FBgn0034299 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001099137.1 Gene:Dtymk / 21915 MGIID:108396 Length:212 Species:Mus musculus


Alignment Length:209 Identity:92/209 - (44%)
Similarity:132/209 - (63%) Gaps:1/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AGKRGALIIFEGCDRSGKTTQSRLLVELLKSKGIPTLPMNFPERSSSIGQVINSYLTNSKDLPDE 67
            |.:|||||:.||.||:|||||...||..|.:.|.....:.|||||:.||:::||||....:|.|.
Mouse     2 ASRRGALIVLEGVDRAGKTTQGLKLVTALCASGHRAELLRFPERSTEIGKLLNSYLEKKTELEDH 66

  Fly    68 VIHLMFSANRWEHINQVKEKLLEGTTLVVDRYSFSGVAYSAAK-GLDFDWCYAPERGLIKPDAVF 131
            .:||:|||||||.:..:|.||.:|.|||:|||:|||||::.|| ....|||..|:.||.|||.:.
Mouse    67 SVHLLFSANRWEQVPLIKAKLNQGVTLVLDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLIL 131

  Fly   132 YLRAPPNDLTHRGQYGKERYEKVEFQGRVAEVFNRICSKEGSYFHQFDARQSVEDLHAQIASITE 196
            :|:....|...||::|.||||...||.:|...|.::..::...:...||.:|:|::|.:|.:.:|
Mouse   132 FLQLQLLDAAARGEFGLERYETGTFQKQVLLCFQQLMEEKNLNWKVVDASKSIEEVHKEIRAHSE 196

  Fly   197 ELLPKVATRPLDTL 210
            :.:...|.|||..|
Mouse   197 DAIRNAAQRPLGEL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5757NP_001261065.1 PLN02924 1..197 CDD:178512 86/194 (44%)
Thymidylate_kin 12..191 CDD:280400 79/179 (44%)
DtymkNP_001099137.1 PLN02924 5..211 CDD:178512 91/206 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850286
Domainoid 1 1.000 159 1.000 Domainoid score I4093
eggNOG 1 0.900 - - E1_COG0125
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6285
Inparanoid 1 1.050 181 1.000 Inparanoid score I3980
Isobase 1 0.950 - 0 Normalized mean entropy S1131
OMA 1 1.010 - - QHG54297
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003433
OrthoInspector 1 1.000 - - oto95302
orthoMCL 1 0.900 - - OOG6_100714
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R645
SonicParanoid 1 1.000 - - X2795
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.640

Return to query results.
Submit another query.