DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5757 and DTYMK

DIOPT Version :9

Sequence 1:NP_001261065.1 Gene:CG5757 / 37062 FlyBaseID:FBgn0034299 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001307834.1 Gene:DTYMK / 1841 HGNCID:3061 Length:251 Species:Homo sapiens


Alignment Length:248 Identity:95/248 - (38%)
Similarity:130/248 - (52%) Gaps:40/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AGKRGALIIFEGCDRSGKTTQSRLLVELLKSKGIPTLPMNFPERSSSIGQVINSYLTNSKDLPDE 67
            |.:|||||:.||.||:||:||||.|||.|.:.|.....:.|||||:.||::::|||....|:.|.
Human     2 AARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDH 66

  Fly    68 VIHLMFSANRWE---------------------------------------HINQVKEKLLEGTT 93
            .:||:|||||||                                       |...:||||.:|.|
Human    67 SVHLLFSANRWEQVFILVAQTGVQWGDLGSLQPTPRRFKRFSCLSLSSSCDHRPLIKEKLSQGVT 131

  Fly    94 LVVDRYSFSGVAYSAAK-GLDFDWCYAPERGLIKPDAVFYLRAPPNDLTHRGQYGKERYEKVEFQ 157
            ||||||:|||||::.|| ....|||..|:.||.|||.|.:|:....|...||.:|.||||...||
Human   132 LVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQ 196

  Fly   158 GRVAEVFNRICSKEGSYFHQFDARQSVEDLHAQIASITEELLPKVATRPLDTL 210
            .|....|:::.......:...||.:|:|.:|..|..::|:.:.....:||..|
Human   197 ERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGEL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5757NP_001261065.1 PLN02924 1..197 CDD:178512 91/233 (39%)
Thymidylate_kin 12..191 CDD:280400 84/218 (39%)
DTYMKNP_001307834.1 PLN02924 2..250 CDD:178512 95/248 (38%)
Thymidylate_kin 11..230 CDD:280400 84/218 (39%)
GVQW 84..>119 CDD:290611 0/34 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159916
Domainoid 1 1.000 165 1.000 Domainoid score I3928
eggNOG 1 0.900 - - E1_COG0125
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6285
Inparanoid 1 1.050 185 1.000 Inparanoid score I3962
Isobase 1 0.950 - 0 Normalized mean entropy S1131
OMA 1 1.010 - - QHG54297
OrthoDB 1 1.010 - - D1259751at2759
OrthoFinder 1 1.000 - - FOG0003433
OrthoInspector 1 1.000 - - oto91720
orthoMCL 1 0.900 - - OOG6_100714
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R645
SonicParanoid 1 1.000 - - X2795
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.650

Return to query results.
Submit another query.