DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10911 and CG30069

DIOPT Version :9

Sequence 1:NP_611286.1 Gene:CG10911 / 37058 FlyBaseID:FBgn0034295 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_610937.4 Gene:CG30069 / 36573 FlyBaseID:FBgn0050069 Length:4012 Species:Drosophila melanogaster


Alignment Length:294 Identity:67/294 - (22%)
Similarity:127/294 - (43%) Gaps:37/294 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DLNACLETASQEVSQINDNTKEERDAIDASAKSSCDALTACSTKEAAIDYFQCYSEAGSNNTKTM 134
            |..|.|.|::...|..:::.....|.:..|...:  :|.|...:.        ||...|.:    
  Fly    46 DAFATLTTSNSSSSMQHESVTYGGDPVGPSTSGA--SLPAAGVRS--------YSSRSSQS---- 96

  Fly   135 FTISANASELLAAVEEEVRLIKVKEEVCTNKTQRAYG-----ESYGQLYADLGDCIAGAPIPSES 194
               .:.||:..::..|:.: .:::.|..::|..|.|.     .|...|.::..:.:...||....
  Fly    97 ---KSKASQSHSSYTEQSQ-SQLQSEQYSSKISRDYANQKIISSIDLLESEKKEPVFSVPIDVVE 157

  Fly   195 TSTQASSTDSSTDSTSASTESSTDSSSVSTESSTDSSSV--STESSTDSSTDSSSAS--TESSTD 255
            .:|...|..:|..|.|....||:.|||...:.::.|||.  :|.||:.|:.::..||  .:::|.
  Fly   158 IATPTLSVSASGGSVSKMFTSSSMSSSQQQQQASSSSSYFEATTSSSRSANETLIASERADTATG 222

  Fly   256 SSSVSTESSTDSSTDSSSVSTESSTDSSTDSSSASTESSTESSSDSPSDSTESST------DSSS 314
            .:|..........||:.:|:..::::|::.|||.||..:..:|....|:.:||.:      ..::
  Fly   223 MTSSGPRKQVGFDTDTKTVTNATTSNSNSSSSSTSTNININTSGSRSSNLSESQSVPKLPMSGTA 287

  Fly   315 VSTESTTSSGEKE----AAPEEDLKSLSSQNSND 344
            .:..|.||.|..|    ::.....|:.||...||
  Fly   288 DAPASVTSQGYPEPVAASSGATTTKATSSTRRND 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10911NP_611286.1 DUF725 48..168 CDD:283039 17/97 (18%)
CG30069NP_610937.4 FhaB <3607..3947 CDD:225751
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28UXN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.