DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10911 and NPIPA7

DIOPT Version :9

Sequence 1:NP_611286.1 Gene:CG10911 / 37058 FlyBaseID:FBgn0034295 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_005255792.1 Gene:NPIPA7 / 101059938 HGNCID:41982 Length:396 Species:Homo sapiens


Alignment Length:66 Identity:13/66 - (19%)
Similarity:28/66 - (42%) Gaps:14/66 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LNACLETASQEVSQIN----DNTKEERDAIDASAKSSCDA----------LTACSTKEAAIDYFQ 121
            :|...:||.:.:.:::    ::.:|||...:|......|.          ..|.:.:..|.||::
Human   163 INGKRKTAKEHLRKLSMKEREHREEERQVSEAEENGKLDMKEIHTYMEMFQRAQALRRRAEDYYR 227

  Fly   122 C 122
            |
Human   228 C 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10911NP_611286.1 DUF725 48..168 CDD:283039 13/66 (20%)
NPIPA7XP_005255792.1 NPIP 49..333 CDD:283949 13/66 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28UXN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.