DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc55B and CG14495

DIOPT Version :10

Sequence 1:NP_611285.2 Gene:Muc55B / 37057 FlyBaseID:FBgn0034294 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_611284.2 Gene:CG14495 / 37056 FlyBaseID:FBgn0034293 Length:193 Species:Drosophila melanogaster


Alignment Length:184 Identity:43/184 - (23%)
Similarity:77/184 - (41%) Gaps:21/184 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLCLLLATSGFALVPKHPADLVSMLARQQFAVRTLMAAPEARDDSTLINDCFNHYLEDQTNVIM 69
            ::||:|..  ||::..:.| ||.:               ||  .|.| |::|.:.:.....|..:
  Fly    22 LILCVLFL--GFSVAGEMP-DLFT---------------PE--PDLT-IDECHDEFTIACANASL 65

  Fly    70 GYNLQYTGCLRTAQSGRDELTKESASEREALLDRTNKMCSSLTECDTLVDGLEFFDCYRNASSDS 134
            .::..|..|...|......|..:...||..:...::.:|.::..||||||.||:|.|.......:
  Fly    66 VFSDSYDLCELNANETIINLEVDVELERLQIELGSSAVCGNMQICDTLVDDLEYFQCINKNGIHN 130

  Fly   135 YKVMFTLNSDSSLDFNRISAKYQVIETDLTDCVDSARLDYAHDMDACDENLTLC 188
            ..::..:|.:::..:.|:...|..:...|..|...|:..|..|:......||.|
  Fly   131 LDILTEINYNATSAYTRLHEDYDAVHRALLLCGLDAQKKYMEDIRQAHRELTKC 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc55BNP_611285.2 DUF725 52..170 CDD:398779 25/117 (21%)
motB <138..307 CDD:183756 11/51 (22%)
rne <258..447 CDD:236766
CG14495NP_611284.2 DUF725 51..168 CDD:398779 25/116 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.