DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc55B and CG5767

DIOPT Version :9

Sequence 1:NP_001286561.1 Gene:Muc55B / 37057 FlyBaseID:FBgn0034294 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_611283.1 Gene:CG5767 / 37055 FlyBaseID:FBgn0034292 Length:253 Species:Drosophila melanogaster


Alignment Length:261 Identity:79/261 - (30%)
Similarity:120/261 - (45%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLC-LLLATSGFALVPKHPADLVSMLARQQFAVRTLMAAPEARD-DSTLIND----CFNHYLEDQ 64
            :|| :|:..|..|...|....|....|..|:.|       .||: |:|:..|    |||.||...
  Fly     3 LLCSVLILASVLAANAKPNVQLQLQSALDQYLV-------HARNLDTTVSADVTTQCFNLYLPML 60

  Fly    65 TNVIMGYNLQYTGCLRTAQSGRDELTKESASEREALLDRTNKMCSSLTECDTLVDGLEFFDCYRN 129
            ..|...::..|..|:.||.:....||.|:..:::........:||:.|.|::..|...||.||.|
  Fly    61 NEVAATFSTSYQACISTANAETANLTAEADKQQKIYQAEVTSLCSAFTACNSDNDTTNFFKCYAN 125

  Fly   130 ASSDSYKVMFTLNSDSSLDFNRISAKYQVIETDLTDCVDSARLDYAHDMDACDENLTLCLKGGET 194
            |:.....|::.:.::::...|.:|...|.|:.....|.::...:|..|..|..:.|..|||.|  
  Fly   126 AAESDVSVIYGIATNAASSANSLSTGIQAIQDTEYQCTNTTESNYVRDTAATYDLLDSCLKYG-- 188

  Fly   195 SPEPTVPTTTSGTPVTVTTPEAPVSTTPEAPVT--TTPVAPST--TETPVPTTPVAPSTTEAPVS 255
                 ||||::..|    :..:||.::..||||  ||.||.||  .:|.|..|..||.|. ||.:
  Fly   189 -----VPTTSTAAP----SSTSPVDSSSGAPVTDGTTVVASSTAAADTTVAVTTAAPGTA-APAT 243

  Fly   256 T 256
            |
  Fly   244 T 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc55BNP_001286561.1 DUF725 52..170 CDD:283039 31/121 (26%)
CG5767NP_611283.1 DUF725 48..168 CDD:283039 30/119 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006718
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.