DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc55B and Prg4

DIOPT Version :9

Sequence 1:NP_001286561.1 Gene:Muc55B / 37057 FlyBaseID:FBgn0034294 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001099432.4 Gene:Prg4 / 289104 RGDID:1308976 Length:1275 Species:Rattus norvegicus


Alignment Length:404 Identity:163/404 - (40%)
Similarity:211/404 - (52%) Gaps:56/404 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 TNKMCSSLTECDTLVDGLEFFDCYRNASSDSYKVMFTLNSDSSLDFNRISAKYQVIETDLTDCVD 168
            |:|..||.:..:|.|:..|..:  .|..|.:.|...|.::..:......|||  .:|...|...:
  Rat   265 TSKEASSTSNKETTVETKETTE--TNKQSSASKKEKTTSAKETRSAENTSAK--DVEPTSTTPKN 325

  Fly   169 SARLDYAHDMDACDENLTLCLKGGE-TSPEPTVPTTTSGTPVTV-------------TTPEAPVS 219
            ||.......:....|.:....||.| ||.|| .|||.....:|:             |||:.|..
  Rat   326 SAPTTTKKPVTTTKEPVPTTTKGPEPTSKEP-APTTPKEPELTIPKEPAPTTKKPAPTTPKEPAP 389

  Fly   220 TTPEAPVTTTP--VAPSTTETPVPTTP--VAPSTTEAPVSTTPEAPVSTTPVAPS-TTEAPVPTT 279
            |||:.|..|||  .||:|.:.|.||||  .||:|.:.|..|||:.|..|||..|: ||:.|.|||
  Rat   390 TTPKEPEPTTPKESAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPAPTTKKPEPTT 454

  Fly   280 P--VAPSTTEAPVPTTP--VAPSTTEAPVPTTPVAPSTTEAPVPTTPVAPSTT--EAPVPTTP-- 336
            |  .||:|.:.|.||||  .||:|.:.|.||||      :.|.||||..|.:|  :.|.||||  
  Rat   455 PKEPAPTTPKEPAPTTPKEPAPNTPKEPAPTTP------KEPAPTTPKEPESTTPKEPAPTTPKE 513

  Fly   337 VAPSTTEAPVPTTP--VAPSTTEAPVPTTP--VAPSTTEAPVPTTP--VAPSTTEAPVPTTPVAP 395
            .||:|.:.|.||||  .||:|.:.|.||||  .||:|.:.|.||||  .||:|.:.||||||..|
  Rat   514 PAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPVPTTPKEP 578

  Fly   396 STT--EAPVPTTP--VAPSTTEAPVPTTP--VASSTTEAPVSTTPVAPSTT----EAPVSSTPES 450
            ::|  :.|.||||  .||:|.:.|.||||  .|.:|.:.|..|||..|:.|    .||....||.
  Rat   579 ASTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPALTTPKEPAPTPKEPEP 643

  Fly   451 TT--EAASTTERSP 462
            ||  |.|.||.:.|
  Rat   644 TTPKEPAPTTPKEP 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc55BNP_001286561.1 DUF725 52..170 CDD:283039 16/65 (25%)
Prg4NP_001099432.4 SO 26..68 CDD:197571
SO 67..108 CDD:197571
PHA03247 <315..724 CDD:223021 149/350 (43%)
HX 1013..1274 CDD:238046
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.