DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5767 and CG5770

DIOPT Version :9

Sequence 1:NP_611283.1 Gene:CG5767 / 37055 FlyBaseID:FBgn0034292 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_611282.1 Gene:CG5770 / 37054 FlyBaseID:FBgn0034291 Length:213 Species:Drosophila melanogaster


Alignment Length:208 Identity:156/208 - (75%)
Similarity:185/208 - (88%) Gaps:6/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLCSVLILASVLAANAKPNVQLQLQSALDQYLVHARNLDTTVSADVTTQCFNLYLPMLNEVAA 65
            |.:||:|||.|||||||||||  .|:||||||||||||:|||.||.|:||||||||:||||:|||
  Fly     1 MNILCTVLIFASVLAANAKPN--NQIQSALDQYLVHARSLDTFVSEDMTTQCFNLYMPMLNQVAA 63

  Fly    66 TFSTSYQACISTANAETANLTAEADKQQKIYQAEVTSLCSAFTACNSDNDTTNFFKCYANAAESD 130
            |||:|||.||:||||:.|||||:|::|||.||::|::||||||||:|:|||.|||.||||||::|
  Fly    64 TFSSSYQDCITTANAQIANLTAQAEQQQKTYQSDVSTLCSAFTACDSNNDTANFFNCYANAADND 128

  Fly   131 VSVIYGIATNAASSANSLSTGIQAIQDTEYQCTNTTESNYVRDTAATYDLLDSCLKYGVPTT--- 192
            |||||.:|:||||||.|.|:||||||||||||||||::||||||||||||||:|||.|||||   
  Fly   129 VSVIYNLASNAASSATSFSSGIQAIQDTEYQCTNTTQNNYVRDTAATYDLLDNCLKNGVPTTTAT 193

  Fly   193 -STAAPSSTSPVD 204
             |:|||.:||..|
  Fly   194 SSSAAPQTTSTTD 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5767NP_611283.1 DUF725 48..168 CDD:283039 91/119 (76%)
CG5770NP_611282.1 DUF725 47..165 CDD:283039 90/117 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469389
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28Q1Z
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006718
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.