DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14491 and CG14456

DIOPT Version :9

Sequence 1:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:154 Identity:27/154 - (17%)
Similarity:52/154 - (33%) Gaps:59/154 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PSFNIELQFKKPVAKFFVNMRIVLPRRFGDDFTLFNL-SGIDGCSLL--SNKNQI-----AFIQL 87
            |..|..::..:.:....:::.:.:..: .|.:...|| :.::.|.:|  :||:.:     .||: 
  Fly    52 PHLNFSMEVHQELHDVDIHVEVRITNK-QDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIR- 114

  Fly    88 GRKHMDRFSNIPKRCP---------------------------WPKDVNYYIRGFRSDMATMPAF 125
                  .|.||.:.||                           ||:|         ...|.:|..
  Fly   115 ------EFGNIVETCPIAKGRYHWHRIHLKRKLQGSYFINKFWWPED---------PTTAMLPEL 164

  Fly   126 NFE-------TDMNLWFELVVNQH 142
            .||       .|.:....|::|.|
  Fly   165 EFEIIWQAMHVDASKKRTLIMNDH 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14491NP_611276.1 DM8 60..150 CDD:214778 25/125 (20%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 24/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.