DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14491 and CG13590

DIOPT Version :9

Sequence 1:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:151 Identity:32/151 - (21%)
Similarity:58/151 - (38%) Gaps:27/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TNCSCSSEDPEGMLSLLKCGL-SKSVKRPSFNIELQFKKPVAKFFVNMRIVLPRRFGDDFTLFNL 67
            ||..|.|.: :..:.:..|.| :.|..:.|.||.:.|.:|.....|:.: .:.:..|....||:.
  Fly    28 TNAVCKSYN-KSWVVVHYCRLKAYSRAKTSLNINVTFVEPARNISVHFK-TMKKANGYKPFLFDY 90

  Fly    68 SGIDGCSLLSNKNQ----IAFIQL-------------GRKHMDRFSNIPKRCPWPKD-----VNY 110
            : .|.|..:..:||    |.:..:             |.:.:..|..:....|.|..     |::
  Fly    91 T-FDACEFMRRRNQPVAKIIWYMIRNVSTINHTCPYEGLQMLSDFHKVDIPVPLPSGDYLLMVDW 154

  Fly   111 YIRGFRSDMATMPAFNFETDM 131
            ...| ::..||...|.|..|:
  Fly   155 LFDG-KTQFATNVYFTFIEDL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14491NP_611276.1 DM8 60..150 CDD:214778 18/94 (19%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 16/89 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.