DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14491 and CG33795

DIOPT Version :10

Sequence 1:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:135 Identity:38/135 - (28%)
Similarity:53/135 - (39%) Gaps:33/135 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TNCSCSSEDPEGMLSLLKCGLSKSV--KRPSFNIELQFKKPVAKFFVNMRIVLPRRFGDDFTLFN 66
            ||..|.|.: :..:::.:|.| |:|  .|..||.......|.....::.|. |.|..|....|:.
  Fly    29 TNVICESRN-QSWVTINECRL-KAVNRNRTVFNFNATIHHPTNDVVIDYRF-LKRENGYKPWLYK 90

  Fly    67 LSGIDGCSLLSNKNQIAFIQLGRKHMDR-----------FSNIPKRCPWPKDVNYYIRG--FRSD 118
             ..||||..|            ||..|.           ||||...||:..|:  .|||  .|::
  Fly    91 -KNIDGCRFL------------RKPYDMLTKMIYMVFKPFSNINHTCPFYGDI--LIRGMYLRTE 140

  Fly   119 MATMP 123
            :..||
  Fly   141 IKAMP 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14491NP_611276.1 DM8 60..150 CDD:214778 22/77 (29%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 25/85 (29%)

Return to query results.
Submit another query.