DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14491 and dls

DIOPT Version :10

Sequence 1:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001368948.1 Gene:dls / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster


Alignment Length:114 Identity:31/114 - (27%)
Similarity:55/114 - (48%) Gaps:14/114 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFTNCSCSSEDPEGMLSLLKCGLSKSVKRPSFNIELQFK---KPVAKFFVNMRIVLP-RRFGDD 61
            :.|||.:|||.:.: .:|...|.: |:|.|....|.:..|   .|:    |:.|:.:. |||...
  Fly    21 VTFTNLNCSSYNLD-FMSFPTCRI-KAVNRTHKYISIYAKLNQVPI----VDARVTIQFRRFDSG 79

  Fly    62 FT--LFNLSGIDGCSLLSNKNQIAFIQLGRKHMDRFSNIPKRCPWPKDV 108
            :.  |::|| .|||..:..:..: .::...:...|.:||...||:..|:
  Fly    80 YKPFLYDLS-YDGCKFMKTQKNV-LVKTFYRTFQRNTNINHTCPYDHDL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14491NP_611276.1 DM8 60..150 CDD:214778 12/51 (24%)
dlsNP_001368948.1 DUF1091 73..153 CDD:461928 15/56 (27%)

Return to query results.
Submit another query.