DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14491 and CG33700

DIOPT Version :10

Sequence 1:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster


Alignment Length:138 Identity:32/138 - (23%)
Similarity:57/138 - (41%) Gaps:32/138 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NCSCSSEDPEGMLSLLKCGLSKSVKRPSFNIELQF-KKPVAKFF------------VNMRIVLPR 56
            |..|.|.| ..:.:..:|             |::| ::.||.|:            |::.:.|.:
  Fly    27 NVICESFD-NAITNFSRC-------------EMKFIRRGVAAFYMVWKLYNVPIKSVDINVALYK 77

  Fly    57 RF-GDDFTLFNLSGIDGCSLLSNKNQIAFIQLGRKHMDRFSNIPKRCPWPKD--VNYYIRGFRSD 118
            :. |....|||.: :|.|..:.|......|.:..|...:.|||...||:..|  :|.:|.. ::|
  Fly    78 KSNGYRPFLFNQT-LDFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINEFIYK-KND 140

  Fly   119 MATMPAFN 126
            :..:|..|
  Fly   141 LKDLPIPN 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14491NP_611276.1 DM8 60..150 CDD:214778 19/69 (28%)
CG33700NP_001027121.3 DUF1091 71..153 CDD:461928 21/80 (26%)

Return to query results.
Submit another query.