DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14491 and CG33758

DIOPT Version :9

Sequence 1:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster


Alignment Length:132 Identity:29/132 - (21%)
Similarity:57/132 - (43%) Gaps:17/132 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FTNCSCSSEDPEGMLSLLKCGLSKSVK--RPSFNIELQFKKPVAKFFVNMRIVLPRRFGDDFTLF 65
            |.:..|::.| :.....|.|.| |::.  |.|.:::.:.|:||:|.|:.:.. ..|..|....|:
  Fly    21 FKSLHCAAFD-QDFGEFLLCKL-KAISRLRNSISVQYKLKQPVSKIFIRLEF-FKRANGWRPFLY 82

  Fly    66 NLSGIDGCSLLSNKNQIAFIQLGRKHMDRFSNIPKRCPWPKDVNYYIRGFRSDMATMPAFNFETD 130
            |.:. :.|..|:..|.: .:.:|..::..:......||:....|          ..:...:||.|
  Fly    83 NFTA-NLCDFLARNNNV-IMGIGYAYLRPYLVKNYSCPFKVIEN----------ELLECKDFELD 135

  Fly   131 MN 132
            :|
  Fly   136 IN 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14491NP_611276.1 DM8 60..150 CDD:214778 13/73 (18%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:284008 15/85 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.