DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14491 and CG33792

DIOPT Version :10

Sequence 1:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:186 Identity:39/186 - (20%)
Similarity:70/186 - (37%) Gaps:64/186 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FTNCSCSSEDPEGMLSLLK-CGLSKSVKRPSFNIELQFKKPVAKFFVNMRIVLPRRFGDDFTLFN 66
            |:|.||          :|| ...::||    .|::...|:.:....:::.:.    :.|...|:.
  Fly    45 FSNVSC----------ILKPVNWTRSV----LNMDGDIKEALTDIKMSVEVF----YKDSSNLYK 91

  Fly    67 LSGI----DGCSLLSNKNQIAFIQ-LGRKHMDRFSNIPKRCPWPKDVNYY--------------- 111
            ...:    |.|.||.||.|..|:| ....|:..::|:...||:...:..|               
  Fly    92 PFAVKFKFDVCQLLKNKTQSNFLQKYAISHLTEWTNVNHSCPYRVSLCIYNIVKFSQYIEYIYMF 156

  Fly   112 ------IRGFRSDMATMP---------AFNFETDMN---------LWFELVVNQHK 143
                  .|.||.|..::|         |||| :..|         ::||::.:.:|
  Fly   157 LKGHLIARNFRLDEVSLPILPIQDYKIAFNF-SGANPGIHLGLVLIYFEILEDYYK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14491NP_611276.1 DM8 60..150 CDD:214778 29/128 (23%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 21/104 (20%)

Return to query results.
Submit another query.