DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14491 and CG33798

DIOPT Version :10

Sequence 1:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster


Alignment Length:167 Identity:44/167 - (26%)
Similarity:67/167 - (40%) Gaps:39/167 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TNCSCSSEDPEGMLSLLKCGLSKSVKRPSFNIELQ---FKKPVAKFFVNMRIVLPRRFGDDFTLF 65
            ||..|.|.| ........|.| |||.|....|.|:   |:.||.:..||..| ..|..|....|:
  Fly    24 TNFECESLD-RNFSDFEYCRL-KSVNRTYKYISLKVHLFQTPVNQIKVNTAI-YKRLNGYKPFLY 85

  Fly    66 NLSGIDGCSLLSNKNQIAFIQLGRKHMDRF--------SNIPKRCPWPKD----------VNYYI 112
            |:: :|||..:.|:|.        ..:.:|        :|:...||:..|          :|:.|
  Fly    86 NVT-VDGCKFIKNQNS--------NPVTKFIFGVFKDATNMNHSCPYDHDIIMEKLSAESINFQI 141

  Fly   113 RGFRSDMATMPAFNFETDMNLWFELVVNQHKLIRGFI 149
                :.:...|...:...|| ||...:|: .:||.:|
  Fly   142 ----TKILPFPEGKYMVKMN-WFAYDINR-AIIRLYI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14491NP_611276.1 DM8 60..150 CDD:214778 23/108 (21%)
CG33798NP_001027414.1 DUF1091 69..154 CDD:461928 20/98 (20%)

Return to query results.
Submit another query.