DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14491 and CG33688

DIOPT Version :10

Sequence 1:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster


Alignment Length:160 Identity:40/160 - (25%)
Similarity:66/160 - (41%) Gaps:25/160 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFTNCSCSSEDPEGMLSLLKCGLSKSVKRPS--FNIELQFKKPVAKFFVNMRIVLPRRFGDDFT 63
            :.|||..|.... |.:....||.: |:|.|..  .:|.:...:.|..   |:.::...|..:.:.
  Fly    21 VTFTNLKCGIRG-EKIYYFEKCFI-KAVNRTHKYIDIYVNLHQQVVN---NVTVIKLMRHNNGYK 80

  Fly    64 LFNLS-GIDGCSLLSNKNQIAFIQLGRKHMDRF---SNIPKRCPWPKDV----NYYIRGFRSD-M 119
            .|.:. .||.|..|.:..|    .:.:|..|.:   |||...||: |||    :.:.....|| |
  Fly    81 PFFVDVTIDVCKFLKDPRQ----SIIKKLYDIYKNNSNINHTCPY-KDVVIVHHLWTGNLESDFM 140

  Fly   120 ATMPAFNFETDMNLWFELVVNQHKLIRGFI 149
            ..:|.  .:.|..::.|..|  :.:.|.||
  Fly   141 KYLPL--IDGDYAIYTEWSV--YNVARAFI 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14491NP_611276.1 DM8 60..150 CDD:214778 26/99 (26%)
CG33688NP_001027131.1 DUF1091 72..152 CDD:461928 22/86 (26%)

Return to query results.
Submit another query.