DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14491 and CG33922

DIOPT Version :10

Sequence 1:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:110 Identity:30/110 - (27%)
Similarity:47/110 - (42%) Gaps:9/110 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FTNCSCSSEDPEGMLSLLKCGLSKSVKRP----SFNIELQFKKPVAKFFVNMRIVLPRRFGDDFT 63
            |||..|.:.|||  .::......|||.|.    |..::| .|.||:...:|: ....|..|....
  Fly    26 FTNIKCVTLDPE--FAVFHYCFLKSVNRTYKYYSLKVKL-LKTPVSNVKINI-ATFQRLNGYKPF 86

  Fly    64 LFNLSGIDGCSLLSNKNQIAFIQLGRKHMDRFSNIPKRCPWPKDV 108
            |:|:: :|||....::...............:|||...||:..|:
  Fly    87 LYNVT-VDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDI 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14491NP_611276.1 DM8 60..150 CDD:214778 11/49 (22%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:461928 14/61 (23%)

Return to query results.
Submit another query.